Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LAU40_RS08930 | Genome accession | NZ_CP083604 |
| Coordinates | 1683624..1684106 (-) | Length | 160 a.a. |
| NCBI ID | WP_224186889.1 | Uniprot ID | - |
| Organism | Macrococcus armenti strain JEK46 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1654822..1691343 | 1683624..1684106 | within | 0 |
Gene organization within MGE regions
Location: 1654822..1691343
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LAU40_RS08730 (LAU40_08730) | - | 1654822..1655769 (-) | 948 | WP_224186833.1 | SH3 domain-containing protein | - |
| LAU40_RS08735 (LAU40_08735) | - | 1655802..1656287 (-) | 486 | WP_224186834.1 | phage holin family protein | - |
| LAU40_RS08740 (LAU40_08740) | - | 1656288..1656566 (-) | 279 | WP_224186836.1 | hypothetical protein | - |
| LAU40_RS08745 (LAU40_08745) | - | 1656610..1656753 (-) | 144 | WP_224186837.1 | hypothetical protein | - |
| LAU40_RS08750 (LAU40_08750) | - | 1656737..1661506 (-) | 4770 | WP_224186839.1 | phage tail spike protein | - |
| LAU40_RS08755 (LAU40_08755) | - | 1661522..1663003 (-) | 1482 | WP_224186840.1 | phage distal tail protein | - |
| LAU40_RS08760 (LAU40_08760) | - | 1663013..1666366 (-) | 3354 | WP_224186842.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| LAU40_RS08765 (LAU40_08765) | - | 1666548..1667216 (-) | 669 | WP_224186843.1 | hypothetical protein | - |
| LAU40_RS08770 (LAU40_08770) | - | 1667298..1668164 (-) | 867 | WP_224186845.1 | hypothetical protein | - |
| LAU40_RS08775 (LAU40_08775) | gpGT | 1668203..1668352 (-) | 150 | WP_224182933.1 | phage tail assembly chaperone GT | - |
| LAU40_RS08780 (LAU40_08780) | gpG | 1668385..1668723 (-) | 339 | WP_224186846.1 | phage tail assembly chaperone G | - |
| LAU40_RS08785 (LAU40_08785) | - | 1668749..1668943 (-) | 195 | WP_224186848.1 | hypothetical protein | - |
| LAU40_RS08790 (LAU40_08790) | - | 1669021..1669635 (-) | 615 | WP_224186850.1 | major tail protein | - |
| LAU40_RS08795 (LAU40_08795) | - | 1669649..1670065 (-) | 417 | WP_224186851.1 | hypothetical protein | - |
| LAU40_RS08800 (LAU40_08800) | - | 1670062..1670457 (-) | 396 | WP_224186852.1 | hypothetical protein | - |
| LAU40_RS08805 (LAU40_08805) | - | 1670447..1670824 (-) | 378 | WP_224186854.1 | hypothetical protein | - |
| LAU40_RS08810 (LAU40_08810) | - | 1670778..1671092 (-) | 315 | WP_224186855.1 | phage gp6-like head-tail connector protein | - |
| LAU40_RS08815 (LAU40_08815) | - | 1671101..1671262 (-) | 162 | WP_224186856.1 | hypothetical protein | - |
| LAU40_RS08820 (LAU40_08820) | - | 1671306..1672520 (-) | 1215 | WP_224186858.1 | phage major capsid protein | - |
| LAU40_RS08825 (LAU40_08825) | - | 1672532..1673320 (-) | 789 | WP_224186859.1 | head maturation protease, ClpP-related | - |
| LAU40_RS08830 (LAU40_08830) | - | 1673317..1674459 (-) | 1143 | WP_224186860.1 | phage portal protein | - |
| LAU40_RS08835 (LAU40_08835) | - | 1674470..1676149 (-) | 1680 | WP_224186861.1 | terminase TerL endonuclease subunit | - |
| LAU40_RS08840 (LAU40_08840) | - | 1676146..1676439 (-) | 294 | WP_224186862.1 | P27 family phage terminase small subunit | - |
| LAU40_RS08845 (LAU40_08845) | - | 1676599..1676916 (-) | 318 | WP_224186863.1 | HNH endonuclease | - |
| LAU40_RS08850 (LAU40_08850) | - | 1677111..1677680 (-) | 570 | WP_224186864.1 | hypothetical protein | - |
| LAU40_RS08855 (LAU40_08855) | - | 1677884..1678432 (-) | 549 | WP_101175971.1 | site-specific integrase | - |
| LAU40_RS08860 (LAU40_08860) | - | 1678429..1678881 (-) | 453 | WP_224186865.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LAU40_RS08865 (LAU40_08865) | - | 1678954..1679166 (-) | 213 | WP_224186867.1 | hypothetical protein | - |
| LAU40_RS08870 (LAU40_08870) | - | 1679177..1679767 (-) | 591 | WP_224202642.1 | hypothetical protein | - |
| LAU40_RS08875 (LAU40_08875) | - | 1679760..1680176 (-) | 417 | WP_224186871.1 | hypothetical protein | - |
| LAU40_RS12475 | - | 1680173..1680304 (-) | 132 | WP_277602616.1 | hypothetical protein | - |
| LAU40_RS08880 (LAU40_08880) | - | 1680301..1680498 (-) | 198 | WP_224186873.1 | hypothetical protein | - |
| LAU40_RS08885 (LAU40_08885) | - | 1680518..1680739 (-) | 222 | WP_224186874.1 | hypothetical protein | - |
| LAU40_RS08890 (LAU40_08890) | - | 1680881..1681087 (-) | 207 | WP_224186876.1 | hypothetical protein | - |
| LAU40_RS08895 (LAU40_08895) | - | 1681101..1681325 (-) | 225 | WP_224186877.1 | hypothetical protein | - |
| LAU40_RS08900 (LAU40_08900) | - | 1681335..1681487 (-) | 153 | WP_224186879.1 | hypothetical protein | - |
| LAU40_RS08905 (LAU40_08905) | - | 1681498..1682010 (-) | 513 | WP_224186881.1 | Holliday junction resolvase RecU | - |
| LAU40_RS08910 (LAU40_08910) | - | 1682209..1682742 (-) | 534 | WP_224186883.1 | MazG-like family protein | - |
| LAU40_RS08915 (LAU40_08915) | - | 1682755..1682997 (-) | 243 | WP_224186884.1 | hypothetical protein | - |
| LAU40_RS08920 (LAU40_08920) | - | 1683010..1683258 (-) | 249 | WP_224186886.1 | hypothetical protein | - |
| LAU40_RS08925 (LAU40_08925) | - | 1683274..1683609 (-) | 336 | WP_224186888.1 | hypothetical protein | - |
| LAU40_RS08930 (LAU40_08930) | ssbA | 1683624..1684106 (-) | 483 | WP_224186889.1 | single-stranded DNA-binding protein | Machinery gene |
| LAU40_RS08935 (LAU40_08935) | - | 1684103..1684489 (-) | 387 | WP_224186891.1 | hypothetical protein | - |
| LAU40_RS08940 (LAU40_08940) | - | 1684585..1684785 (+) | 201 | WP_224186892.1 | hypothetical protein | - |
| LAU40_RS08945 (LAU40_08945) | - | 1684760..1684951 (-) | 192 | WP_224186894.1 | hypothetical protein | - |
| LAU40_RS08950 (LAU40_08950) | - | 1685009..1685389 (+) | 381 | WP_224186895.1 | DUF2513 domain-containing protein | - |
| LAU40_RS08955 (LAU40_08955) | - | 1685381..1685587 (-) | 207 | WP_224186897.1 | hypothetical protein | - |
| LAU40_RS08960 (LAU40_08960) | - | 1685589..1685891 (-) | 303 | WP_224186898.1 | hypothetical protein | - |
| LAU40_RS12590 | - | 1685884..1686354 (-) | 471 | WP_420907992.1 | DnaD domain-containing protein | - |
| LAU40_RS12595 | - | 1686373..1686840 (-) | 468 | Protein_1778 | helix-turn-helix domain-containing protein | - |
| LAU40_RS08970 (LAU40_08970) | - | 1686877..1687128 (-) | 252 | WP_224186901.1 | hypothetical protein | - |
| LAU40_RS08975 (LAU40_08975) | - | 1687118..1687870 (-) | 753 | WP_224186903.1 | BRO family protein | - |
| LAU40_RS08980 (LAU40_08980) | - | 1687961..1688149 (-) | 189 | WP_224186904.1 | hypothetical protein | - |
| LAU40_RS08985 (LAU40_08985) | - | 1688146..1688457 (-) | 312 | WP_224186906.1 | DUF771 domain-containing protein | - |
| LAU40_RS08990 (LAU40_08990) | - | 1688477..1688698 (-) | 222 | WP_224186908.1 | helix-turn-helix transcriptional regulator | - |
| LAU40_RS08995 (LAU40_08995) | - | 1688836..1689465 (+) | 630 | WP_224186910.1 | helix-turn-helix domain-containing protein | - |
| LAU40_RS09000 (LAU40_09000) | - | 1689524..1690171 (+) | 648 | WP_224186912.1 | hypothetical protein | - |
| LAU40_RS09005 (LAU40_09005) | - | 1690285..1691343 (+) | 1059 | WP_224186913.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 160 a.a. Molecular weight: 18050.97 Da Isoelectric Point: 5.2936
>NTDB_id=606557 LAU40_RS08930 WP_224186889.1 1683624..1684106(-) (ssbA) [Macrococcus armenti strain JEK46]
MINRVVLVGRLTKDPEYRVTQSGVAVASFTLAVNRTFTNAQGERQADFINCIVFRKQAEKVNTYLHKGSLAGVDGRLQSR
SYDNQEGRRVFVTEVVCDSVQFLEPKNSRSGTEQYDDYTQAQQTKDYEARNKKAQETMPNTNPFANSDGPIDISDDDLPF
MINRVVLVGRLTKDPEYRVTQSGVAVASFTLAVNRTFTNAQGERQADFINCIVFRKQAEKVNTYLHKGSLAGVDGRLQSR
SYDNQEGRRVFVTEVVCDSVQFLEPKNSRSGTEQYDDYTQAQQTKDYEARNKKAQETMPNTNPFANSDGPIDISDDDLPF
Nucleotide
Download Length: 483 bp
>NTDB_id=606557 LAU40_RS08930 WP_224186889.1 1683624..1684106(-) (ssbA) [Macrococcus armenti strain JEK46]
ATGATAAATAGAGTAGTCCTGGTAGGACGTTTAACAAAAGACCCTGAATATCGAGTTACACAATCTGGAGTAGCAGTAGC
ATCGTTCACATTAGCAGTAAATCGCACATTTACAAATGCACAAGGAGAACGACAAGCAGACTTCATAAACTGCATCGTAT
TCAGAAAGCAAGCAGAGAAAGTTAATACTTACTTGCATAAAGGGAGCTTAGCTGGTGTCGATGGCAGATTACAATCACGC
AGCTATGACAATCAAGAAGGCAGACGAGTATTTGTTACCGAAGTTGTTTGTGATTCAGTTCAATTCCTGGAGCCTAAAAA
TTCAAGAAGTGGCACAGAGCAATATGATGATTATACACAAGCACAACAAACTAAAGATTATGAAGCACGTAATAAGAAAG
CTCAGGAGACTATGCCAAATACAAATCCATTCGCTAATTCTGATGGACCTATTGATATTAGCGATGATGATTTACCGTTT
TAA
ATGATAAATAGAGTAGTCCTGGTAGGACGTTTAACAAAAGACCCTGAATATCGAGTTACACAATCTGGAGTAGCAGTAGC
ATCGTTCACATTAGCAGTAAATCGCACATTTACAAATGCACAAGGAGAACGACAAGCAGACTTCATAAACTGCATCGTAT
TCAGAAAGCAAGCAGAGAAAGTTAATACTTACTTGCATAAAGGGAGCTTAGCTGGTGTCGATGGCAGATTACAATCACGC
AGCTATGACAATCAAGAAGGCAGACGAGTATTTGTTACCGAAGTTGTTTGTGATTCAGTTCAATTCCTGGAGCCTAAAAA
TTCAAGAAGTGGCACAGAGCAATATGATGATTATACACAAGCACAACAAACTAAAGATTATGAAGCACGTAATAAGAAAG
CTCAGGAGACTATGCCAAATACAAATCCATTCGCTAATTCTGATGGACCTATTGATATTAGCGATGATGATTTACCGTTT
TAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.631 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.55 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
66.25 |
0.394 |