Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LAU39_RS08950 | Genome accession | NZ_CP083602 |
| Coordinates | 1683596..1684078 (-) | Length | 160 a.a. |
| NCBI ID | WP_224186889.1 | Uniprot ID | - |
| Organism | Macrococcus armenti strain JEK29 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1654794..1691315 | 1683596..1684078 | within | 0 |
Gene organization within MGE regions
Location: 1654794..1691315
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LAU39_RS08750 (LAU39_08750) | - | 1654794..1655741 (-) | 948 | WP_224186833.1 | SH3 domain-containing protein | - |
| LAU39_RS08755 (LAU39_08755) | - | 1655774..1656259 (-) | 486 | WP_224186834.1 | phage holin family protein | - |
| LAU39_RS08760 (LAU39_08760) | - | 1656260..1656538 (-) | 279 | WP_224186836.1 | hypothetical protein | - |
| LAU39_RS08765 (LAU39_08765) | - | 1656582..1656725 (-) | 144 | WP_224186837.1 | hypothetical protein | - |
| LAU39_RS08770 (LAU39_08770) | - | 1656709..1661478 (-) | 4770 | WP_224186839.1 | phage tail spike protein | - |
| LAU39_RS08775 (LAU39_08775) | - | 1661494..1662975 (-) | 1482 | WP_224186840.1 | phage distal tail protein | - |
| LAU39_RS08780 (LAU39_08780) | - | 1662985..1666338 (-) | 3354 | WP_224186842.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| LAU39_RS08785 (LAU39_08785) | - | 1666520..1667188 (-) | 669 | WP_224186843.1 | hypothetical protein | - |
| LAU39_RS08790 (LAU39_08790) | - | 1667270..1668136 (-) | 867 | WP_224186845.1 | hypothetical protein | - |
| LAU39_RS08795 (LAU39_08795) | gpGT | 1668175..1668324 (-) | 150 | WP_224182933.1 | phage tail assembly chaperone GT | - |
| LAU39_RS08800 (LAU39_08800) | gpG | 1668357..1668695 (-) | 339 | WP_224186846.1 | phage tail assembly chaperone G | - |
| LAU39_RS08805 (LAU39_08805) | - | 1668721..1668915 (-) | 195 | WP_224186848.1 | hypothetical protein | - |
| LAU39_RS08810 (LAU39_08810) | - | 1668993..1669607 (-) | 615 | WP_224186850.1 | major tail protein | - |
| LAU39_RS08815 (LAU39_08815) | - | 1669621..1670037 (-) | 417 | WP_224186851.1 | hypothetical protein | - |
| LAU39_RS08820 (LAU39_08820) | - | 1670034..1670429 (-) | 396 | WP_224186852.1 | hypothetical protein | - |
| LAU39_RS08825 (LAU39_08825) | - | 1670419..1670796 (-) | 378 | WP_224186854.1 | hypothetical protein | - |
| LAU39_RS08830 (LAU39_08830) | - | 1670750..1671064 (-) | 315 | WP_224186855.1 | phage gp6-like head-tail connector protein | - |
| LAU39_RS08835 (LAU39_08835) | - | 1671073..1671234 (-) | 162 | WP_224186856.1 | hypothetical protein | - |
| LAU39_RS08840 (LAU39_08840) | - | 1671278..1672492 (-) | 1215 | WP_224186858.1 | phage major capsid protein | - |
| LAU39_RS08845 (LAU39_08845) | - | 1672504..1673292 (-) | 789 | WP_224186859.1 | head maturation protease, ClpP-related | - |
| LAU39_RS08850 (LAU39_08850) | - | 1673289..1674431 (-) | 1143 | WP_224186860.1 | phage portal protein | - |
| LAU39_RS08855 (LAU39_08855) | - | 1674442..1676121 (-) | 1680 | WP_224186861.1 | terminase TerL endonuclease subunit | - |
| LAU39_RS08860 (LAU39_08860) | - | 1676118..1676411 (-) | 294 | WP_224186862.1 | P27 family phage terminase small subunit | - |
| LAU39_RS08865 (LAU39_08865) | - | 1676571..1676888 (-) | 318 | WP_224186863.1 | HNH endonuclease | - |
| LAU39_RS08870 (LAU39_08870) | - | 1677083..1677652 (-) | 570 | WP_224186864.1 | hypothetical protein | - |
| LAU39_RS08875 (LAU39_08875) | - | 1677856..1678404 (-) | 549 | WP_101175971.1 | site-specific integrase | - |
| LAU39_RS08880 (LAU39_08880) | - | 1678401..1678853 (-) | 453 | WP_224186865.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LAU39_RS08885 (LAU39_08885) | - | 1678926..1679138 (-) | 213 | WP_224186867.1 | hypothetical protein | - |
| LAU39_RS08890 (LAU39_08890) | - | 1679149..1679748 (-) | 600 | WP_224186869.1 | hypothetical protein | - |
| LAU39_RS08895 (LAU39_08895) | - | 1679732..1680148 (-) | 417 | WP_224186871.1 | hypothetical protein | - |
| LAU39_RS11980 | - | 1680145..1680276 (-) | 132 | WP_277602616.1 | hypothetical protein | - |
| LAU39_RS08900 (LAU39_08900) | - | 1680273..1680470 (-) | 198 | WP_224186873.1 | hypothetical protein | - |
| LAU39_RS08905 (LAU39_08905) | - | 1680490..1680711 (-) | 222 | WP_224186874.1 | hypothetical protein | - |
| LAU39_RS08910 (LAU39_08910) | - | 1680853..1681059 (-) | 207 | WP_224186876.1 | hypothetical protein | - |
| LAU39_RS08915 (LAU39_08915) | - | 1681073..1681297 (-) | 225 | WP_224186877.1 | hypothetical protein | - |
| LAU39_RS08920 (LAU39_08920) | - | 1681307..1681459 (-) | 153 | WP_224186879.1 | hypothetical protein | - |
| LAU39_RS08925 (LAU39_08925) | - | 1681470..1681982 (-) | 513 | WP_224186881.1 | Holliday junction resolvase RecU | - |
| LAU39_RS08930 (LAU39_08930) | - | 1682181..1682714 (-) | 534 | WP_224186883.1 | MazG-like family protein | - |
| LAU39_RS08935 (LAU39_08935) | - | 1682727..1682969 (-) | 243 | WP_224186884.1 | hypothetical protein | - |
| LAU39_RS08940 (LAU39_08940) | - | 1682982..1683230 (-) | 249 | WP_224186886.1 | hypothetical protein | - |
| LAU39_RS08945 (LAU39_08945) | - | 1683246..1683581 (-) | 336 | WP_224186888.1 | hypothetical protein | - |
| LAU39_RS08950 (LAU39_08950) | ssbA | 1683596..1684078 (-) | 483 | WP_224186889.1 | single-stranded DNA-binding protein | Machinery gene |
| LAU39_RS08955 (LAU39_08955) | - | 1684075..1684461 (-) | 387 | WP_224186891.1 | hypothetical protein | - |
| LAU39_RS08960 (LAU39_08960) | - | 1684557..1684757 (+) | 201 | WP_224186892.1 | hypothetical protein | - |
| LAU39_RS08965 (LAU39_08965) | - | 1684732..1684923 (-) | 192 | WP_224186894.1 | hypothetical protein | - |
| LAU39_RS08970 (LAU39_08970) | - | 1684981..1685361 (+) | 381 | WP_224186895.1 | DUF2513 domain-containing protein | - |
| LAU39_RS08975 (LAU39_08975) | - | 1685353..1685559 (-) | 207 | WP_224186897.1 | hypothetical protein | - |
| LAU39_RS08980 (LAU39_08980) | - | 1685561..1685863 (-) | 303 | WP_224186898.1 | hypothetical protein | - |
| LAU39_RS12090 | - | 1685856..1686326 (-) | 471 | WP_420907992.1 | DnaD domain-containing protein | - |
| LAU39_RS12095 | - | 1686345..1686812 (-) | 468 | Protein_1781 | helix-turn-helix domain-containing protein | - |
| LAU39_RS08990 (LAU39_08990) | - | 1686849..1687100 (-) | 252 | WP_224186901.1 | hypothetical protein | - |
| LAU39_RS08995 (LAU39_08995) | - | 1687090..1687842 (-) | 753 | WP_224186903.1 | BRO family protein | - |
| LAU39_RS09000 (LAU39_09000) | - | 1687933..1688121 (-) | 189 | WP_224186904.1 | hypothetical protein | - |
| LAU39_RS09005 (LAU39_09005) | - | 1688118..1688429 (-) | 312 | WP_224186906.1 | DUF771 domain-containing protein | - |
| LAU39_RS09010 (LAU39_09010) | - | 1688449..1688670 (-) | 222 | WP_224186908.1 | helix-turn-helix transcriptional regulator | - |
| LAU39_RS09015 (LAU39_09015) | - | 1688808..1689437 (+) | 630 | WP_224186910.1 | helix-turn-helix domain-containing protein | - |
| LAU39_RS09020 (LAU39_09020) | - | 1689496..1690143 (+) | 648 | WP_224186912.1 | hypothetical protein | - |
| LAU39_RS09025 (LAU39_09025) | - | 1690257..1691315 (+) | 1059 | WP_224186913.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 160 a.a. Molecular weight: 18050.97 Da Isoelectric Point: 5.2936
>NTDB_id=606529 LAU39_RS08950 WP_224186889.1 1683596..1684078(-) (ssbA) [Macrococcus armenti strain JEK29]
MINRVVLVGRLTKDPEYRVTQSGVAVASFTLAVNRTFTNAQGERQADFINCIVFRKQAEKVNTYLHKGSLAGVDGRLQSR
SYDNQEGRRVFVTEVVCDSVQFLEPKNSRSGTEQYDDYTQAQQTKDYEARNKKAQETMPNTNPFANSDGPIDISDDDLPF
MINRVVLVGRLTKDPEYRVTQSGVAVASFTLAVNRTFTNAQGERQADFINCIVFRKQAEKVNTYLHKGSLAGVDGRLQSR
SYDNQEGRRVFVTEVVCDSVQFLEPKNSRSGTEQYDDYTQAQQTKDYEARNKKAQETMPNTNPFANSDGPIDISDDDLPF
Nucleotide
Download Length: 483 bp
>NTDB_id=606529 LAU39_RS08950 WP_224186889.1 1683596..1684078(-) (ssbA) [Macrococcus armenti strain JEK29]
ATGATAAATAGAGTAGTCCTGGTAGGACGTTTAACAAAAGACCCTGAATATCGAGTTACACAATCTGGAGTAGCAGTAGC
ATCGTTCACATTAGCAGTAAATCGCACATTTACAAATGCACAAGGAGAACGACAAGCAGACTTCATAAACTGCATCGTAT
TCAGAAAGCAAGCAGAGAAAGTTAATACTTACTTGCATAAAGGGAGCTTAGCTGGTGTCGATGGCAGATTACAATCACGC
AGCTATGACAATCAAGAAGGCAGACGAGTATTTGTTACCGAAGTTGTTTGTGATTCAGTTCAATTCCTGGAGCCTAAAAA
TTCAAGAAGTGGCACAGAGCAATATGATGATTATACACAAGCACAACAAACTAAAGATTATGAAGCACGTAATAAGAAAG
CTCAGGAGACTATGCCAAATACAAATCCATTCGCTAATTCTGATGGACCTATTGATATTAGCGATGATGATTTACCGTTT
TAA
ATGATAAATAGAGTAGTCCTGGTAGGACGTTTAACAAAAGACCCTGAATATCGAGTTACACAATCTGGAGTAGCAGTAGC
ATCGTTCACATTAGCAGTAAATCGCACATTTACAAATGCACAAGGAGAACGACAAGCAGACTTCATAAACTGCATCGTAT
TCAGAAAGCAAGCAGAGAAAGTTAATACTTACTTGCATAAAGGGAGCTTAGCTGGTGTCGATGGCAGATTACAATCACGC
AGCTATGACAATCAAGAAGGCAGACGAGTATTTGTTACCGAAGTTGTTTGTGATTCAGTTCAATTCCTGGAGCCTAAAAA
TTCAAGAAGTGGCACAGAGCAATATGATGATTATACACAAGCACAACAAACTAAAGATTATGAAGCACGTAATAAGAAAG
CTCAGGAGACTATGCCAAATACAAATCCATTCGCTAATTCTGATGGACCTATTGATATTAGCGATGATGATTTACCGTTT
TAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.631 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.55 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
66.25 |
0.394 |