Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   LAU44_RS08920 Genome accession   NZ_CP083598
Coordinates   1683533..1684015 (-) Length   160 a.a.
NCBI ID   WP_224186889.1    Uniprot ID   -
Organism   Macrococcus armenti strain JEK12     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1654731..1691252 1683533..1684015 within 0


Gene organization within MGE regions


Location: 1654731..1691252
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LAU44_RS08720 (LAU44_08720) - 1654731..1655678 (-) 948 WP_224186833.1 SH3 domain-containing protein -
  LAU44_RS08725 (LAU44_08725) - 1655711..1656196 (-) 486 WP_224186834.1 phage holin family protein -
  LAU44_RS08730 (LAU44_08730) - 1656197..1656475 (-) 279 WP_224186836.1 hypothetical protein -
  LAU44_RS08735 (LAU44_08735) - 1656519..1656662 (-) 144 WP_224186837.1 hypothetical protein -
  LAU44_RS08740 (LAU44_08740) - 1656646..1661415 (-) 4770 WP_224186839.1 phage tail spike protein -
  LAU44_RS08745 (LAU44_08745) - 1661431..1662912 (-) 1482 WP_224186840.1 phage distal tail protein -
  LAU44_RS08750 (LAU44_08750) - 1662922..1666275 (-) 3354 WP_224186842.1 peptidoglycan DD-metalloendopeptidase family protein -
  LAU44_RS08755 (LAU44_08755) - 1666457..1667125 (-) 669 WP_224186843.1 hypothetical protein -
  LAU44_RS08760 (LAU44_08760) - 1667207..1668073 (-) 867 WP_224186845.1 hypothetical protein -
  LAU44_RS08765 (LAU44_08765) gpGT 1668112..1668261 (-) 150 WP_224182933.1 phage tail assembly chaperone GT -
  LAU44_RS08770 (LAU44_08770) gpG 1668294..1668632 (-) 339 WP_224186846.1 phage tail assembly chaperone G -
  LAU44_RS08775 (LAU44_08775) - 1668658..1668852 (-) 195 WP_224186848.1 hypothetical protein -
  LAU44_RS08780 (LAU44_08780) - 1668930..1669544 (-) 615 WP_224186850.1 major tail protein -
  LAU44_RS08785 (LAU44_08785) - 1669558..1669974 (-) 417 WP_224186851.1 hypothetical protein -
  LAU44_RS08790 (LAU44_08790) - 1669971..1670366 (-) 396 WP_224186852.1 hypothetical protein -
  LAU44_RS08795 (LAU44_08795) - 1670356..1670733 (-) 378 WP_224186854.1 hypothetical protein -
  LAU44_RS08800 (LAU44_08800) - 1670687..1671001 (-) 315 WP_224186855.1 phage gp6-like head-tail connector protein -
  LAU44_RS08805 (LAU44_08805) - 1671010..1671171 (-) 162 WP_224186856.1 hypothetical protein -
  LAU44_RS08810 (LAU44_08810) - 1671215..1672429 (-) 1215 WP_224186858.1 phage major capsid protein -
  LAU44_RS08815 (LAU44_08815) - 1672441..1673229 (-) 789 WP_224186859.1 head maturation protease, ClpP-related -
  LAU44_RS08820 (LAU44_08820) - 1673226..1674368 (-) 1143 WP_224186860.1 phage portal protein -
  LAU44_RS08825 (LAU44_08825) - 1674379..1676058 (-) 1680 WP_224186861.1 terminase TerL endonuclease subunit -
  LAU44_RS08830 (LAU44_08830) - 1676055..1676348 (-) 294 WP_224186862.1 P27 family phage terminase small subunit -
  LAU44_RS08835 (LAU44_08835) - 1676508..1676825 (-) 318 WP_224186863.1 HNH endonuclease -
  LAU44_RS08840 (LAU44_08840) - 1677020..1677589 (-) 570 WP_224186864.1 hypothetical protein -
  LAU44_RS08845 (LAU44_08845) - 1677793..1678341 (-) 549 WP_101175971.1 site-specific integrase -
  LAU44_RS08850 (LAU44_08850) - 1678338..1678790 (-) 453 WP_224186865.1 ArpU family phage packaging/lysis transcriptional regulator -
  LAU44_RS08855 (LAU44_08855) - 1678863..1679075 (-) 213 WP_224186867.1 hypothetical protein -
  LAU44_RS08860 (LAU44_08860) - 1679086..1679676 (-) 591 WP_224202642.1 hypothetical protein -
  LAU44_RS08865 (LAU44_08865) - 1679669..1680085 (-) 417 WP_224186871.1 hypothetical protein -
  LAU44_RS12440 - 1680082..1680213 (-) 132 WP_277602616.1 hypothetical protein -
  LAU44_RS08870 (LAU44_08870) - 1680210..1680407 (-) 198 WP_224186873.1 hypothetical protein -
  LAU44_RS08875 (LAU44_08875) - 1680427..1680648 (-) 222 WP_224186874.1 hypothetical protein -
  LAU44_RS08880 (LAU44_08880) - 1680790..1680996 (-) 207 WP_224186876.1 hypothetical protein -
  LAU44_RS08885 (LAU44_08885) - 1681010..1681234 (-) 225 WP_224186877.1 hypothetical protein -
  LAU44_RS08890 (LAU44_08890) - 1681244..1681396 (-) 153 WP_224186879.1 hypothetical protein -
  LAU44_RS08895 (LAU44_08895) - 1681407..1681919 (-) 513 WP_224186881.1 Holliday junction resolvase RecU -
  LAU44_RS08900 (LAU44_08900) - 1682118..1682651 (-) 534 WP_224186883.1 MazG-like family protein -
  LAU44_RS08905 (LAU44_08905) - 1682664..1682906 (-) 243 WP_224186884.1 hypothetical protein -
  LAU44_RS08910 (LAU44_08910) - 1682919..1683167 (-) 249 WP_224186886.1 hypothetical protein -
  LAU44_RS08915 (LAU44_08915) - 1683183..1683518 (-) 336 WP_224186888.1 hypothetical protein -
  LAU44_RS08920 (LAU44_08920) ssbA 1683533..1684015 (-) 483 WP_224186889.1 single-stranded DNA-binding protein Machinery gene
  LAU44_RS08925 (LAU44_08925) - 1684012..1684398 (-) 387 WP_224186891.1 hypothetical protein -
  LAU44_RS08930 (LAU44_08930) - 1684494..1684694 (+) 201 WP_224186892.1 hypothetical protein -
  LAU44_RS08935 (LAU44_08935) - 1684669..1684860 (-) 192 WP_224186894.1 hypothetical protein -
  LAU44_RS08940 (LAU44_08940) - 1684918..1685298 (+) 381 WP_224186895.1 DUF2513 domain-containing protein -
  LAU44_RS08945 (LAU44_08945) - 1685290..1685496 (-) 207 WP_224186897.1 hypothetical protein -
  LAU44_RS08950 (LAU44_08950) - 1685498..1685800 (-) 303 WP_224186898.1 hypothetical protein -
  LAU44_RS12545 - 1685793..1686263 (-) 471 WP_420907992.1 DnaD domain-containing protein -
  LAU44_RS12550 - 1686282..1686749 (-) 468 Protein_1777 helix-turn-helix domain-containing protein -
  LAU44_RS08960 (LAU44_08960) - 1686786..1687037 (-) 252 WP_224186901.1 hypothetical protein -
  LAU44_RS08965 (LAU44_08965) - 1687027..1687779 (-) 753 WP_224186903.1 BRO family protein -
  LAU44_RS08970 (LAU44_08970) - 1687870..1688058 (-) 189 WP_224186904.1 hypothetical protein -
  LAU44_RS08975 (LAU44_08975) - 1688055..1688366 (-) 312 WP_224186906.1 DUF771 domain-containing protein -
  LAU44_RS08980 (LAU44_08980) - 1688386..1688607 (-) 222 WP_224186908.1 helix-turn-helix transcriptional regulator -
  LAU44_RS08985 (LAU44_08985) - 1688745..1689374 (+) 630 WP_224186910.1 helix-turn-helix domain-containing protein -
  LAU44_RS08990 (LAU44_08990) - 1689433..1690080 (+) 648 WP_224186912.1 hypothetical protein -
  LAU44_RS08995 (LAU44_08995) - 1690194..1691252 (+) 1059 WP_224186913.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 160 a.a.        Molecular weight: 18050.97 Da        Isoelectric Point: 5.2936

>NTDB_id=606501 LAU44_RS08920 WP_224186889.1 1683533..1684015(-) (ssbA) [Macrococcus armenti strain JEK12]
MINRVVLVGRLTKDPEYRVTQSGVAVASFTLAVNRTFTNAQGERQADFINCIVFRKQAEKVNTYLHKGSLAGVDGRLQSR
SYDNQEGRRVFVTEVVCDSVQFLEPKNSRSGTEQYDDYTQAQQTKDYEARNKKAQETMPNTNPFANSDGPIDISDDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=606501 LAU44_RS08920 WP_224186889.1 1683533..1684015(-) (ssbA) [Macrococcus armenti strain JEK12]
ATGATAAATAGAGTAGTCCTGGTAGGACGTTTAACAAAAGACCCTGAATATCGAGTTACACAATCTGGAGTAGCAGTAGC
ATCGTTCACATTAGCAGTAAATCGCACATTTACAAATGCACAAGGAGAACGACAAGCAGACTTCATAAACTGCATCGTAT
TCAGAAAGCAAGCAGAGAAAGTTAATACTTACTTGCATAAAGGGAGCTTAGCTGGTGTCGATGGCAGATTACAATCACGC
AGCTATGACAATCAAGAAGGCAGACGAGTATTTGTTACCGAAGTTGTTTGTGATTCAGTTCAATTCCTGGAGCCTAAAAA
TTCAAGAAGTGGCACAGAGCAATATGATGATTATACACAAGCACAACAAACTAAAGATTATGAAGCACGTAATAAGAAAG
CTCAGGAGACTATGCCAAATACAAATCCATTCGCTAATTCTGATGGACCTATTGATATTAGCGATGATGATTTACCGTTT
TAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

58.721

100

0.631

  ssb Latilactobacillus sakei subsp. sakei 23K

50

100

0.55

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

66.25

0.394