Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LAU44_RS08920 | Genome accession | NZ_CP083598 |
| Coordinates | 1683533..1684015 (-) | Length | 160 a.a. |
| NCBI ID | WP_224186889.1 | Uniprot ID | - |
| Organism | Macrococcus armenti strain JEK12 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1654731..1691252 | 1683533..1684015 | within | 0 |
Gene organization within MGE regions
Location: 1654731..1691252
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LAU44_RS08720 (LAU44_08720) | - | 1654731..1655678 (-) | 948 | WP_224186833.1 | SH3 domain-containing protein | - |
| LAU44_RS08725 (LAU44_08725) | - | 1655711..1656196 (-) | 486 | WP_224186834.1 | phage holin family protein | - |
| LAU44_RS08730 (LAU44_08730) | - | 1656197..1656475 (-) | 279 | WP_224186836.1 | hypothetical protein | - |
| LAU44_RS08735 (LAU44_08735) | - | 1656519..1656662 (-) | 144 | WP_224186837.1 | hypothetical protein | - |
| LAU44_RS08740 (LAU44_08740) | - | 1656646..1661415 (-) | 4770 | WP_224186839.1 | phage tail spike protein | - |
| LAU44_RS08745 (LAU44_08745) | - | 1661431..1662912 (-) | 1482 | WP_224186840.1 | phage distal tail protein | - |
| LAU44_RS08750 (LAU44_08750) | - | 1662922..1666275 (-) | 3354 | WP_224186842.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| LAU44_RS08755 (LAU44_08755) | - | 1666457..1667125 (-) | 669 | WP_224186843.1 | hypothetical protein | - |
| LAU44_RS08760 (LAU44_08760) | - | 1667207..1668073 (-) | 867 | WP_224186845.1 | hypothetical protein | - |
| LAU44_RS08765 (LAU44_08765) | gpGT | 1668112..1668261 (-) | 150 | WP_224182933.1 | phage tail assembly chaperone GT | - |
| LAU44_RS08770 (LAU44_08770) | gpG | 1668294..1668632 (-) | 339 | WP_224186846.1 | phage tail assembly chaperone G | - |
| LAU44_RS08775 (LAU44_08775) | - | 1668658..1668852 (-) | 195 | WP_224186848.1 | hypothetical protein | - |
| LAU44_RS08780 (LAU44_08780) | - | 1668930..1669544 (-) | 615 | WP_224186850.1 | major tail protein | - |
| LAU44_RS08785 (LAU44_08785) | - | 1669558..1669974 (-) | 417 | WP_224186851.1 | hypothetical protein | - |
| LAU44_RS08790 (LAU44_08790) | - | 1669971..1670366 (-) | 396 | WP_224186852.1 | hypothetical protein | - |
| LAU44_RS08795 (LAU44_08795) | - | 1670356..1670733 (-) | 378 | WP_224186854.1 | hypothetical protein | - |
| LAU44_RS08800 (LAU44_08800) | - | 1670687..1671001 (-) | 315 | WP_224186855.1 | phage gp6-like head-tail connector protein | - |
| LAU44_RS08805 (LAU44_08805) | - | 1671010..1671171 (-) | 162 | WP_224186856.1 | hypothetical protein | - |
| LAU44_RS08810 (LAU44_08810) | - | 1671215..1672429 (-) | 1215 | WP_224186858.1 | phage major capsid protein | - |
| LAU44_RS08815 (LAU44_08815) | - | 1672441..1673229 (-) | 789 | WP_224186859.1 | head maturation protease, ClpP-related | - |
| LAU44_RS08820 (LAU44_08820) | - | 1673226..1674368 (-) | 1143 | WP_224186860.1 | phage portal protein | - |
| LAU44_RS08825 (LAU44_08825) | - | 1674379..1676058 (-) | 1680 | WP_224186861.1 | terminase TerL endonuclease subunit | - |
| LAU44_RS08830 (LAU44_08830) | - | 1676055..1676348 (-) | 294 | WP_224186862.1 | P27 family phage terminase small subunit | - |
| LAU44_RS08835 (LAU44_08835) | - | 1676508..1676825 (-) | 318 | WP_224186863.1 | HNH endonuclease | - |
| LAU44_RS08840 (LAU44_08840) | - | 1677020..1677589 (-) | 570 | WP_224186864.1 | hypothetical protein | - |
| LAU44_RS08845 (LAU44_08845) | - | 1677793..1678341 (-) | 549 | WP_101175971.1 | site-specific integrase | - |
| LAU44_RS08850 (LAU44_08850) | - | 1678338..1678790 (-) | 453 | WP_224186865.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LAU44_RS08855 (LAU44_08855) | - | 1678863..1679075 (-) | 213 | WP_224186867.1 | hypothetical protein | - |
| LAU44_RS08860 (LAU44_08860) | - | 1679086..1679676 (-) | 591 | WP_224202642.1 | hypothetical protein | - |
| LAU44_RS08865 (LAU44_08865) | - | 1679669..1680085 (-) | 417 | WP_224186871.1 | hypothetical protein | - |
| LAU44_RS12440 | - | 1680082..1680213 (-) | 132 | WP_277602616.1 | hypothetical protein | - |
| LAU44_RS08870 (LAU44_08870) | - | 1680210..1680407 (-) | 198 | WP_224186873.1 | hypothetical protein | - |
| LAU44_RS08875 (LAU44_08875) | - | 1680427..1680648 (-) | 222 | WP_224186874.1 | hypothetical protein | - |
| LAU44_RS08880 (LAU44_08880) | - | 1680790..1680996 (-) | 207 | WP_224186876.1 | hypothetical protein | - |
| LAU44_RS08885 (LAU44_08885) | - | 1681010..1681234 (-) | 225 | WP_224186877.1 | hypothetical protein | - |
| LAU44_RS08890 (LAU44_08890) | - | 1681244..1681396 (-) | 153 | WP_224186879.1 | hypothetical protein | - |
| LAU44_RS08895 (LAU44_08895) | - | 1681407..1681919 (-) | 513 | WP_224186881.1 | Holliday junction resolvase RecU | - |
| LAU44_RS08900 (LAU44_08900) | - | 1682118..1682651 (-) | 534 | WP_224186883.1 | MazG-like family protein | - |
| LAU44_RS08905 (LAU44_08905) | - | 1682664..1682906 (-) | 243 | WP_224186884.1 | hypothetical protein | - |
| LAU44_RS08910 (LAU44_08910) | - | 1682919..1683167 (-) | 249 | WP_224186886.1 | hypothetical protein | - |
| LAU44_RS08915 (LAU44_08915) | - | 1683183..1683518 (-) | 336 | WP_224186888.1 | hypothetical protein | - |
| LAU44_RS08920 (LAU44_08920) | ssbA | 1683533..1684015 (-) | 483 | WP_224186889.1 | single-stranded DNA-binding protein | Machinery gene |
| LAU44_RS08925 (LAU44_08925) | - | 1684012..1684398 (-) | 387 | WP_224186891.1 | hypothetical protein | - |
| LAU44_RS08930 (LAU44_08930) | - | 1684494..1684694 (+) | 201 | WP_224186892.1 | hypothetical protein | - |
| LAU44_RS08935 (LAU44_08935) | - | 1684669..1684860 (-) | 192 | WP_224186894.1 | hypothetical protein | - |
| LAU44_RS08940 (LAU44_08940) | - | 1684918..1685298 (+) | 381 | WP_224186895.1 | DUF2513 domain-containing protein | - |
| LAU44_RS08945 (LAU44_08945) | - | 1685290..1685496 (-) | 207 | WP_224186897.1 | hypothetical protein | - |
| LAU44_RS08950 (LAU44_08950) | - | 1685498..1685800 (-) | 303 | WP_224186898.1 | hypothetical protein | - |
| LAU44_RS12545 | - | 1685793..1686263 (-) | 471 | WP_420907992.1 | DnaD domain-containing protein | - |
| LAU44_RS12550 | - | 1686282..1686749 (-) | 468 | Protein_1777 | helix-turn-helix domain-containing protein | - |
| LAU44_RS08960 (LAU44_08960) | - | 1686786..1687037 (-) | 252 | WP_224186901.1 | hypothetical protein | - |
| LAU44_RS08965 (LAU44_08965) | - | 1687027..1687779 (-) | 753 | WP_224186903.1 | BRO family protein | - |
| LAU44_RS08970 (LAU44_08970) | - | 1687870..1688058 (-) | 189 | WP_224186904.1 | hypothetical protein | - |
| LAU44_RS08975 (LAU44_08975) | - | 1688055..1688366 (-) | 312 | WP_224186906.1 | DUF771 domain-containing protein | - |
| LAU44_RS08980 (LAU44_08980) | - | 1688386..1688607 (-) | 222 | WP_224186908.1 | helix-turn-helix transcriptional regulator | - |
| LAU44_RS08985 (LAU44_08985) | - | 1688745..1689374 (+) | 630 | WP_224186910.1 | helix-turn-helix domain-containing protein | - |
| LAU44_RS08990 (LAU44_08990) | - | 1689433..1690080 (+) | 648 | WP_224186912.1 | hypothetical protein | - |
| LAU44_RS08995 (LAU44_08995) | - | 1690194..1691252 (+) | 1059 | WP_224186913.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 160 a.a. Molecular weight: 18050.97 Da Isoelectric Point: 5.2936
>NTDB_id=606501 LAU44_RS08920 WP_224186889.1 1683533..1684015(-) (ssbA) [Macrococcus armenti strain JEK12]
MINRVVLVGRLTKDPEYRVTQSGVAVASFTLAVNRTFTNAQGERQADFINCIVFRKQAEKVNTYLHKGSLAGVDGRLQSR
SYDNQEGRRVFVTEVVCDSVQFLEPKNSRSGTEQYDDYTQAQQTKDYEARNKKAQETMPNTNPFANSDGPIDISDDDLPF
MINRVVLVGRLTKDPEYRVTQSGVAVASFTLAVNRTFTNAQGERQADFINCIVFRKQAEKVNTYLHKGSLAGVDGRLQSR
SYDNQEGRRVFVTEVVCDSVQFLEPKNSRSGTEQYDDYTQAQQTKDYEARNKKAQETMPNTNPFANSDGPIDISDDDLPF
Nucleotide
Download Length: 483 bp
>NTDB_id=606501 LAU44_RS08920 WP_224186889.1 1683533..1684015(-) (ssbA) [Macrococcus armenti strain JEK12]
ATGATAAATAGAGTAGTCCTGGTAGGACGTTTAACAAAAGACCCTGAATATCGAGTTACACAATCTGGAGTAGCAGTAGC
ATCGTTCACATTAGCAGTAAATCGCACATTTACAAATGCACAAGGAGAACGACAAGCAGACTTCATAAACTGCATCGTAT
TCAGAAAGCAAGCAGAGAAAGTTAATACTTACTTGCATAAAGGGAGCTTAGCTGGTGTCGATGGCAGATTACAATCACGC
AGCTATGACAATCAAGAAGGCAGACGAGTATTTGTTACCGAAGTTGTTTGTGATTCAGTTCAATTCCTGGAGCCTAAAAA
TTCAAGAAGTGGCACAGAGCAATATGATGATTATACACAAGCACAACAAACTAAAGATTATGAAGCACGTAATAAGAAAG
CTCAGGAGACTATGCCAAATACAAATCCATTCGCTAATTCTGATGGACCTATTGATATTAGCGATGATGATTTACCGTTT
TAA
ATGATAAATAGAGTAGTCCTGGTAGGACGTTTAACAAAAGACCCTGAATATCGAGTTACACAATCTGGAGTAGCAGTAGC
ATCGTTCACATTAGCAGTAAATCGCACATTTACAAATGCACAAGGAGAACGACAAGCAGACTTCATAAACTGCATCGTAT
TCAGAAAGCAAGCAGAGAAAGTTAATACTTACTTGCATAAAGGGAGCTTAGCTGGTGTCGATGGCAGATTACAATCACGC
AGCTATGACAATCAAGAAGGCAGACGAGTATTTGTTACCGAAGTTGTTTGTGATTCAGTTCAATTCCTGGAGCCTAAAAA
TTCAAGAAGTGGCACAGAGCAATATGATGATTATACACAAGCACAACAAACTAAAGATTATGAAGCACGTAATAAGAAAG
CTCAGGAGACTATGCCAAATACAAATCCATTCGCTAATTCTGATGGACCTATTGATATTAGCGATGATGATTTACCGTTT
TAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.631 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.55 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
66.25 |
0.394 |