Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BAJP3144_RS15925 Genome accession   NZ_CP082283
Coordinates   3209727..3209867 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain JP3144     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3204727..3214867
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAJP3144_RS15900 (BAJP3144_15900) - 3205054..3205437 (-) 384 WP_017419422.1 hotdog fold thioesterase -
  BAJP3144_RS15905 (BAJP3144_15905) comA 3205459..3206103 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  BAJP3144_RS15910 (BAJP3144_15910) comP 3206184..3208490 (-) 2307 WP_222893417.1 sensor histidine kinase Regulator
  BAJP3144_RS15915 (BAJP3144_15915) comX 3208509..3208685 (-) 177 WP_017419424.1 competence pheromone ComX -
  BAJP3144_RS15920 (BAJP3144_15920) - 3208700..3209575 (-) 876 WP_110124799.1 polyprenyl synthetase family protein -
  BAJP3144_RS15925 (BAJP3144_15925) degQ 3209727..3209867 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BAJP3144_RS15930 (BAJP3144_15930) - 3210332..3210673 (+) 342 WP_021495366.1 hypothetical protein -
  BAJP3144_RS15935 (BAJP3144_15935) - 3210680..3211903 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  BAJP3144_RS15940 (BAJP3144_15940) - 3212033..3213499 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BAJP3144_RS15945 (BAJP3144_15945) - 3213517..3214068 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  BAJP3144_RS15950 (BAJP3144_15950) - 3214165..3214563 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=601057 BAJP3144_RS15925 WP_003152043.1 3209727..3209867(-) (degQ) [Bacillus amyloliquefaciens strain JP3144]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=601057 BAJP3144_RS15925 WP_003152043.1 3209727..3209867(-) (degQ) [Bacillus amyloliquefaciens strain JP3144]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891