Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   K4A81_RS16315 Genome accession   NZ_CP082262
Coordinates   3258874..3259014 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain BIM B-454D     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3253874..3264014
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K4A81_RS16290 (K4A81_16290) - 3254220..3254603 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  K4A81_RS16295 (K4A81_16295) comA 3254625..3255269 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  K4A81_RS16300 (K4A81_16300) comP 3255350..3257650 (-) 2301 WP_222885027.1 histidine kinase Regulator
  K4A81_RS16305 (K4A81_16305) comX 3257664..3257837 (-) 174 WP_180997901.1 competence pheromone ComX -
  K4A81_RS16310 (K4A81_16310) - 3257806..3258666 (-) 861 WP_180997900.1 polyprenyl synthetase family protein -
  K4A81_RS16315 (K4A81_16315) degQ 3258874..3259014 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  K4A81_RS16320 (K4A81_16320) - 3259480..3259821 (+) 342 WP_103526655.1 hypothetical protein -
  K4A81_RS16325 (K4A81_16325) - 3259828..3261051 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  K4A81_RS16330 (K4A81_16330) - 3261181..3262647 (-) 1467 WP_222885028.1 nicotinate phosphoribosyltransferase -
  K4A81_RS16335 (K4A81_16335) - 3262665..3263216 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  K4A81_RS16340 (K4A81_16340) - 3263313..3263711 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=600581 K4A81_RS16315 WP_003152043.1 3258874..3259014(-) (degQ) [Bacillus velezensis strain BIM B-454D]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=600581 K4A81_RS16315 WP_003152043.1 3258874..3259014(-) (degQ) [Bacillus velezensis strain BIM B-454D]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891