Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | L897_RS04785 | Genome accession | NC_021807 |
| Coordinates | 964214..964402 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes HSC5 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 956626..1011962 | 964214..964402 | within | 0 |
Gene organization within MGE regions
Location: 956626..1011962
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L897_RS04755 (L897_04885) | pfkA | 956626..957639 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| L897_RS04760 (L897_04890) | - | 957719..960829 (-) | 3111 | WP_020833514.1 | DNA polymerase III subunit alpha | - |
| L897_RS04765 (L897_04895) | - | 961014..961385 (+) | 372 | WP_042361506.1 | GntR family transcriptional regulator | - |
| L897_RS04770 (L897_04900) | - | 961385..962083 (+) | 699 | WP_002992425.1 | ABC transporter ATP-binding protein | - |
| L897_RS04775 (L897_04905) | - | 962093..962878 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| L897_RS04780 (L897_04910) | - | 963009..963623 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| L897_RS04785 (L897_04915) | prx | 964214..964402 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| L897_RS04790 (L897_04920) | spel | 964517..965305 (-) | 789 | WP_020833516.1 | streptococcal pyrogenic exotoxin SpeL | - |
| L897_RS04795 (L897_04925) | spem | 965587..966300 (-) | 714 | WP_014635497.1 | streptococcal pyrogenic exotoxin SpeM | - |
| L897_RS04800 (L897_04930) | - | 966604..967470 (-) | 867 | WP_014635498.1 | DUF334 domain-containing protein | - |
| L897_RS04805 (L897_04935) | - | 967458..967982 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| L897_RS04810 (L897_04940) | - | 968122..969327 (-) | 1206 | WP_020833517.1 | glucosaminidase domain-containing protein | - |
| L897_RS04820 (L897_04950) | - | 969443..969670 (-) | 228 | WP_003058873.1 | phage holin | - |
| L897_RS04825 (L897_04955) | - | 969667..969942 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| L897_RS04830 (L897_04960) | - | 969952..970569 (-) | 618 | WP_020833519.1 | DUF1366 domain-containing protein | - |
| L897_RS04835 (L897_04965) | - | 970572..971003 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| L897_RS04840 (L897_04970) | - | 971015..972901 (-) | 1887 | WP_020833520.1 | gp58-like family protein | - |
| L897_RS04845 (L897_04975) | hylP | 972916..973929 (-) | 1014 | WP_010922091.1 | hyaluronidase HylP | - |
| L897_RS04850 (L897_04980) | - | 973926..975977 (-) | 2052 | WP_020833521.1 | phage tail spike protein | - |
| L897_RS04855 (L897_04985) | - | 975974..976753 (-) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| L897_RS04860 (L897_04990) | - | 976785..980408 (-) | 3624 | WP_020833522.1 | tape measure protein | - |
| L897_RS04865 (L897_04995) | - | 980423..980752 (-) | 330 | WP_020833523.1 | hypothetical protein | - |
| L897_RS04870 (L897_05000) | - | 980794..981153 (-) | 360 | Protein_923 | tail assembly chaperone | - |
| L897_RS04875 (L897_05005) | - | 981213..981725 (-) | 513 | WP_075340257.1 | phage major tail protein, TP901-1 family | - |
| L897_RS04880 (L897_05010) | - | 981822..982211 (-) | 390 | WP_020833525.1 | hypothetical protein | - |
| L897_RS04885 (L897_05015) | - | 982208..982573 (-) | 366 | WP_002984399.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| L897_RS04890 (L897_05020) | - | 982554..982862 (-) | 309 | WP_002984393.1 | hypothetical protein | - |
| L897_RS04895 (L897_05025) | - | 982859..983212 (-) | 354 | WP_010922219.1 | phage head-tail connector protein | - |
| L897_RS04900 (L897_05030) | - | 983224..983490 (-) | 267 | WP_002990031.1 | HeH/LEM domain-containing protein | - |
| L897_RS04905 (L897_05035) | - | 983502..984551 (-) | 1050 | WP_020833526.1 | major capsid protein | - |
| L897_RS04910 (L897_05040) | - | 984554..984934 (-) | 381 | WP_020833527.1 | hypothetical protein | - |
| L897_RS04915 (L897_05045) | - | 984944..985477 (-) | 534 | WP_020833528.1 | DUF4355 domain-containing protein | - |
| L897_RS04920 (L897_05050) | - | 985621..985880 (-) | 260 | Protein_933 | hypothetical protein | - |
| L897_RS04925 (L897_05055) | - | 985883..986197 (-) | 315 | WP_011284859.1 | hypothetical protein | - |
| L897_RS04930 (L897_05060) | - | 986267..986452 (-) | 186 | WP_002988389.1 | hypothetical protein | - |
| L897_RS04935 (L897_05065) | - | 986456..988018 (-) | 1563 | WP_020833529.1 | phage head morphogenesis protein | - |
| L897_RS04940 (L897_05070) | - | 987999..989501 (-) | 1503 | WP_002984369.1 | phage portal protein | - |
| L897_RS04945 (L897_05075) | - | 989513..990820 (-) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| L897_RS04950 (L897_05080) | - | 990798..991229 (-) | 432 | WP_020833531.1 | terminase small subunit | - |
| L897_RS04955 (L897_05085) | - | 991328..991513 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| L897_RS04960 (L897_05090) | - | 991565..991942 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| L897_RS09680 (L897_05095) | - | 992237..992470 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| L897_RS04970 (L897_05100) | - | 992560..993474 (-) | 915 | WP_020833532.1 | hypothetical protein | - |
| L897_RS04975 (L897_05105) | - | 994052..994486 (-) | 435 | WP_020833533.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| L897_RS04980 (L897_05110) | - | 994760..995395 (-) | 636 | WP_020833534.1 | N-6 DNA methylase | - |
| L897_RS04985 (L897_05115) | - | 995397..995681 (-) | 285 | WP_020833535.1 | hypothetical protein | - |
| L897_RS04990 (L897_05120) | - | 995678..996058 (-) | 381 | WP_020833536.1 | YopX family protein | - |
| L897_RS04995 (L897_05125) | - | 996068..996337 (-) | 270 | WP_020833537.1 | hypothetical protein | - |
| L897_RS05000 (L897_05130) | - | 996334..996609 (-) | 276 | WP_020833538.1 | nucleotide modification associated domain-containing protein | - |
| L897_RS09945 | - | 996606..996837 (-) | 232 | Protein_950 | hypothetical protein | - |
| L897_RS05005 (L897_05135) | - | 996834..997190 (-) | 357 | WP_020833539.1 | hypothetical protein | - |
| L897_RS05010 (L897_05140) | - | 997174..997458 (-) | 285 | WP_011017874.1 | VRR-NUC domain-containing protein | - |
| L897_RS05015 (L897_05145) | - | 997478..998347 (-) | 870 | WP_020833541.1 | bifunctional DNA primase/polymerase | - |
| L897_RS05020 (L897_05150) | - | 998614..1000167 (-) | 1554 | WP_020833542.1 | hypothetical protein | - |
| L897_RS05025 (L897_05155) | - | 1000185..1000667 (-) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| L897_RS05030 (L897_05160) | - | 1000672..1002105 (-) | 1434 | Protein_956 | DEAD/DEAH box helicase | - |
| L897_RS05035 (L897_05165) | - | 1002111..1002794 (-) | 684 | WP_002984321.1 | AAA family ATPase | - |
| L897_RS05040 (L897_05170) | - | 1002791..1003075 (-) | 285 | WP_002984318.1 | hypothetical protein | - |
| L897_RS05045 (L897_05175) | - | 1003072..1003266 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| L897_RS05050 (L897_05180) | - | 1003266..1003595 (-) | 330 | WP_020833543.1 | hypothetical protein | - |
| L897_RS09285 (L897_05190) | - | 1003676..1003813 (-) | 138 | WP_002984309.1 | hypothetical protein | - |
| L897_RS05055 (L897_05195) | - | 1003810..1004106 (-) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| L897_RS05060 (L897_05200) | - | 1004185..1004370 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| L897_RS05065 (L897_05205) | - | 1004537..1004776 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| L897_RS05070 (L897_05210) | - | 1004926..1005135 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| L897_RS05080 (L897_05220) | - | 1005394..1005903 (+) | 510 | WP_011017884.1 | hypothetical protein | - |
| L897_RS05085 (L897_05225) | - | 1006011..1006238 (-) | 228 | WP_002984281.1 | hypothetical protein | - |
| L897_RS05090 (L897_05230) | - | 1006312..1006698 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| L897_RS05095 (L897_05235) | - | 1006687..1006896 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| L897_RS05100 (L897_05240) | - | 1006950..1007549 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| L897_RS09290 (L897_05245) | - | 1007579..1007737 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| L897_RS05105 (L897_05255) | - | 1008097..1008840 (+) | 744 | WP_020837244.1 | S24 family peptidase | - |
| L897_RS05110 (L897_05260) | - | 1008876..1009769 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| L897_RS05115 (L897_05265) | - | 1009886..1010974 (+) | 1089 | WP_020837246.1 | site-specific integrase | - |
| L897_RS05120 | - | 1011337..1011962 (+) | 626 | Protein_975 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=59934 L897_RS04785 WP_011054546.1 964214..964402(-) (prx) [Streptococcus pyogenes HSC5]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=59934 L897_RS04785 WP_011054546.1 964214..964402(-) (prx) [Streptococcus pyogenes HSC5]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |