Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   K4L72_RS12715 Genome accession   NZ_CP081304
Coordinates   2616791..2617168 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus velezensis strain CL-4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2611791..2622168
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K4L72_RS12675 (K4L72_12675) - 2612290..2613084 (+) 795 WP_014305407.1 YqhG family protein -
  K4L72_RS12680 (K4L72_12680) sinI 2613261..2613434 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  K4L72_RS12685 (K4L72_12685) sinR 2613468..2613803 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  K4L72_RS12690 (K4L72_12690) tasA 2613851..2614636 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  K4L72_RS12695 (K4L72_12695) sipW 2614700..2615284 (-) 585 WP_003153100.1 signal peptidase I SipW -
  K4L72_RS12700 (K4L72_12700) tapA 2615256..2615927 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  K4L72_RS12705 (K4L72_12705) - 2616186..2616515 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  K4L72_RS12710 (K4L72_12710) - 2616555..2616734 (-) 180 WP_003153093.1 YqzE family protein -
  K4L72_RS12715 (K4L72_12715) comGG 2616791..2617168 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  K4L72_RS12720 (K4L72_12720) comGF 2617169..2617669 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  K4L72_RS12725 (K4L72_12725) comGE 2617578..2617892 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  K4L72_RS12730 (K4L72_12730) comGD 2617876..2618313 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  K4L72_RS12735 (K4L72_12735) comGC 2618303..2618611 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  K4L72_RS12740 (K4L72_12740) comGB 2618616..2619653 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  K4L72_RS12745 (K4L72_12745) comGA 2619640..2620710 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  K4L72_RS12750 (K4L72_12750) - 2620902..2621852 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=595907 K4L72_RS12715 WP_003153092.1 2616791..2617168(-) (comGG) [Bacillus velezensis strain CL-4]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=595907 K4L72_RS12715 WP_003153092.1 2616791..2617168(-) (comGG) [Bacillus velezensis strain CL-4]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512