Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | K4L72_RS12680 | Genome accession | NZ_CP081304 |
| Coordinates | 2613261..2613434 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain CL-4 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2608261..2618434
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K4L72_RS12665 (K4L72_12665) | gcvT | 2609079..2610179 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| K4L72_RS12670 (K4L72_12670) | - | 2610602..2612272 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| K4L72_RS12675 (K4L72_12675) | - | 2612290..2613084 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| K4L72_RS12680 (K4L72_12680) | sinI | 2613261..2613434 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| K4L72_RS12685 (K4L72_12685) | sinR | 2613468..2613803 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| K4L72_RS12690 (K4L72_12690) | tasA | 2613851..2614636 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| K4L72_RS12695 (K4L72_12695) | sipW | 2614700..2615284 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| K4L72_RS12700 (K4L72_12700) | tapA | 2615256..2615927 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| K4L72_RS12705 (K4L72_12705) | - | 2616186..2616515 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| K4L72_RS12710 (K4L72_12710) | - | 2616555..2616734 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| K4L72_RS12715 (K4L72_12715) | comGG | 2616791..2617168 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| K4L72_RS12720 (K4L72_12720) | comGF | 2617169..2617669 (-) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| K4L72_RS12725 (K4L72_12725) | comGE | 2617578..2617892 (-) | 315 | WP_003153089.1 | competence type IV pilus minor pilin ComGE | - |
| K4L72_RS12730 (K4L72_12730) | comGD | 2617876..2618313 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=595905 K4L72_RS12680 WP_003153105.1 2613261..2613434(+) (sinI) [Bacillus velezensis strain CL-4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=595905 K4L72_RS12680 WP_003153105.1 2613261..2613434(+) (sinI) [Bacillus velezensis strain CL-4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |