Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   LOCK919_RS10225 Genome accession   NC_021721
Coordinates   2077446..2077931 (-) Length   161 a.a.
NCBI ID   WP_020751636.1    Uniprot ID   -
Organism   Lacticaseibacillus paracasei     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2044863..2085081 2077446..2077931 within 0


Gene organization within MGE regions


Location: 2044863..2085081
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LOCK919_RS10015 (LOCK919_2091) - 2044863..2046278 (-) 1416 WP_020751600.1 reverse transcriptase/maturase family protein -
  LOCK919_RS17035 (LOCK919_2092) - 2046424..2046576 (+) 153 WP_003566290.1 hypothetical protein -
  LOCK919_RS10020 (LOCK919_2093) - 2047031..2048083 (-) 1053 WP_020751601.1 N-acetylmuramoyl-L-alanine amidase -
  LOCK919_RS10025 (LOCK919_2094) - 2048085..2048357 (-) 273 WP_020751602.1 hypothetical protein -
  LOCK919_RS10030 - 2048347..2048580 (-) 234 WP_041168859.1 hypothetical protein -
  LOCK919_RS10035 - 2048573..2048950 (-) 378 WP_041168860.1 hypothetical protein -
  LOCK919_RS10040 (LOCK919_2096) - 2048963..2052982 (-) 4020 WP_020751604.1 CotH kinase family protein -
  LOCK919_RS10045 (LOCK919_2097) - 2052951..2055053 (-) 2103 WP_020751605.1 phage tail protein -
  LOCK919_RS10050 (LOCK919_2098) - 2055066..2055884 (-) 819 WP_020751606.1 phage tail domain-containing protein -
  LOCK919_RS10055 (LOCK919_2099) - 2055888..2058884 (-) 2997 WP_020751607.1 phage tail tape measure protein -
  LOCK919_RS10060 (LOCK919_2100) - 2058884..2059117 (-) 234 WP_020751608.1 hypothetical protein -
  LOCK919_RS10065 (LOCK919_2101) - 2059189..2059629 (-) 441 WP_020751609.1 tail assembly chaperone -
  LOCK919_RS10070 (LOCK919_2102) - 2059693..2060322 (-) 630 WP_020751610.1 phage major tail protein, TP901-1 family -
  LOCK919_RS10075 (LOCK919_2103) - 2060325..2060690 (-) 366 WP_020751611.1 hypothetical protein -
  LOCK919_RS10080 (LOCK919_2104) - 2060687..2061061 (-) 375 WP_020751612.1 HK97-gp10 family putative phage morphogenesis protein -
  LOCK919_RS10085 - 2061054..2061350 (-) 297 WP_041168861.1 hypothetical protein -
  LOCK919_RS10090 (LOCK919_2106) - 2061347..2061688 (-) 342 WP_020751614.1 phage head-tail connector protein -
  LOCK919_RS10095 (LOCK919_2107) - 2061685..2062563 (-) 879 WP_020751615.1 hypothetical protein -
  LOCK919_RS10100 (LOCK919_2108) - 2062632..2063552 (-) 921 WP_020751616.1 phage capsid protein -
  LOCK919_RS10105 (LOCK919_2109) - 2063566..2064105 (-) 540 WP_020751617.1 DUF4355 domain-containing protein -
  LOCK919_RS10110 (LOCK919_2110) - 2064277..2064618 (-) 342 WP_020751618.1 hypothetical protein -
  LOCK919_RS10115 (LOCK919_2111) - 2064628..2065440 (-) 813 WP_237740260.1 phage head morphogenesis protein -
  LOCK919_RS10120 (LOCK919_2112) - 2065364..2066884 (-) 1521 WP_020751620.1 phage portal protein -
  LOCK919_RS10125 (LOCK919_2113) - 2066886..2068178 (-) 1293 WP_020751621.1 PBSX family phage terminase large subunit -
  LOCK919_RS10130 (LOCK919_2114) - 2068168..2068719 (-) 552 WP_020751622.1 terminase small subunit -
  LOCK919_RS17040 (LOCK919_2115) - 2068719..2068856 (-) 138 WP_020751623.1 hypothetical protein -
  LOCK919_RS10135 (LOCK919_2116) - 2068866..2070014 (-) 1149 WP_020751624.1 GcrA family cell cycle regulator -
  LOCK919_RS10140 - 2070039..2070293 (-) 255 WP_016372095.1 hypothetical protein -
  LOCK919_RS10150 - 2070652..2071095 (-) 444 WP_041168864.1 ArpU family phage packaging/lysis transcriptional regulator -
  LOCK919_RS10155 (LOCK919_2117) - 2071578..2071766 (-) 189 WP_020751625.1 hypothetical protein -
  LOCK919_RS10160 - 2071763..2072050 (-) 288 WP_041168865.1 hypothetical protein -
  LOCK919_RS10165 (LOCK919_2118) - 2072047..2072418 (-) 372 WP_020751626.1 DUF1642 domain-containing protein -
  LOCK919_RS10170 - 2072415..2072807 (-) 393 WP_041168866.1 hypothetical protein -
  LOCK919_RS10175 (LOCK919_2119) - 2072797..2073015 (-) 219 WP_020751627.1 hypothetical protein -
  LOCK919_RS10180 (LOCK919_2120) - 2072999..2073310 (-) 312 WP_020751628.1 hypothetical protein -
  LOCK919_RS10185 - 2073307..2073513 (-) 207 WP_041168867.1 hypothetical protein -
  LOCK919_RS10190 (LOCK919_2121) - 2073506..2074072 (-) 567 WP_020751629.1 DUF1642 domain-containing protein -
  LOCK919_RS10195 (LOCK919_2122) - 2074069..2074332 (-) 264 WP_020751630.1 hypothetical protein -
  LOCK919_RS10200 (LOCK919_2123) - 2074345..2074953 (-) 609 WP_020751631.1 hypothetical protein -
  LOCK919_RS10205 (LOCK919_2124) - 2074964..2075887 (-) 924 WP_020751632.1 site-specific integrase -
  LOCK919_RS10210 (LOCK919_2125) - 2075874..2076584 (-) 711 WP_020751633.1 N-6 DNA methylase -
  LOCK919_RS10215 (LOCK919_2126) - 2076595..2076978 (-) 384 WP_020751634.1 DUF1064 domain-containing protein -
  LOCK919_RS10220 (LOCK919_2127) - 2076981..2077430 (-) 450 WP_020751635.1 hypothetical protein -
  LOCK919_RS10225 (LOCK919_2128) ssb 2077446..2077931 (-) 486 WP_020751636.1 single-stranded DNA-binding protein Machinery gene
  LOCK919_RS10230 (LOCK919_2129) - 2077944..2078897 (-) 954 WP_020751637.1 DnaD domain protein -
  LOCK919_RS10235 (LOCK919_2130) - 2078913..2079713 (-) 801 WP_080652413.1 PD-(D/E)XK nuclease-like domain-containing protein -
  LOCK919_RS10240 (LOCK919_2131) - 2079694..2080560 (-) 867 WP_020751639.1 recombinase RecT -
  LOCK919_RS10245 (LOCK919_2132) - 2080573..2080980 (-) 408 WP_016371376.1 hypothetical protein -
  LOCK919_RS17255 (LOCK919_2133) - 2081081..2081209 (-) 129 WP_020751640.1 hypothetical protein -
  LOCK919_RS10250 (LOCK919_2134) - 2081222..2081431 (-) 210 WP_019885644.1 hypothetical protein -
  LOCK919_RS10255 (LOCK919_2135) - 2081437..2081943 (-) 507 WP_004562014.1 hypothetical protein -
  LOCK919_RS16105 (LOCK919_2136) - 2082001..2082159 (-) 159 WP_016376224.1 hypothetical protein -
  LOCK919_RS10260 (LOCK919_2137) - 2082156..2082401 (-) 246 WP_020751641.1 helix-turn-helix transcriptional regulator -
  LOCK919_RS10265 (LOCK919_2138) - 2082531..2083214 (+) 684 WP_020751642.1 helix-turn-helix domain-containing protein -
  LOCK919_RS10270 (LOCK919_2139) - 2083230..2083808 (+) 579 WP_041168868.1 hypothetical protein -
  LOCK919_RS10275 (LOCK919_2140) - 2083918..2085081 (+) 1164 WP_020751644.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 161 a.a.        Molecular weight: 17625.32 Da        Isoelectric Point: 6.9828

>NTDB_id=59576 LOCK919_RS10225 WP_020751636.1 2077446..2077931(-) (ssb) [Lacticaseibacillus paracasei]
MLNSVSLTGRLTRDVDLRYTQSGTAAGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTKKGSLVGVEGHIQTR
TYDNAQGQKVFVTEVIVENFALLESRQASQNNPKSQQTANASATATTNTSQTTPNASRANATDPFANNGQPIDIQDDDLP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=59576 LOCK919_RS10225 WP_020751636.1 2077446..2077931(-) (ssb) [Lacticaseibacillus paracasei]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGCGGCAGG
ATCATTCACGCTGGCAGTTGATCGCAAATTCAAGAGCAAAAACGGAGAACGAGAAACAGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAACTTCACCAAAAAAGGCTCATTGGTTGGTGTGGAAGGCCATATCCAAACGCGT
ACGTACGATAACGCGCAAGGGCAGAAAGTATTCGTGACCGAGGTAATCGTTGAGAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAACAGCGACCACAAACACGAGTCAAACGACTC
CAAATGCTTCGCGAGCGAATGCCACGGATCCGTTTGCTAATAATGGCCAGCCAATAGACATCCAAGATGATGATTTGCCA
TTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

62.209

100

0.665
  ssbA Bacillus subtilis subsp. subtilis str. 168

50

100

0.534

Multiple sequence alignment