Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   K0V03_RS05455 Genome accession   NZ_CP080508
Coordinates   979529..979669 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain HD15     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 974529..984669
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K0V03_RS05430 (K0V03_05430) yuxO 974879..975259 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  K0V03_RS05435 (K0V03_05435) comA 975278..975922 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  K0V03_RS05440 (K0V03_05440) comP 976003..978300 (-) 2298 WP_085185942.1 histidine kinase Regulator
  K0V03_RS05445 (K0V03_05445) comX 978308..978469 (-) 162 WP_003241045.1 competence pheromone ComX -
  K0V03_RS05450 (K0V03_05450) - 978484..979344 (-) 861 WP_032677058.1 polyprenyl synthetase family protein -
  K0V03_RS05455 (K0V03_05455) degQ 979529..979669 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  K0V03_RS05460 (K0V03_05460) - 979891..980016 (+) 126 WP_120028613.1 hypothetical protein -
  K0V03_RS05465 (K0V03_05465) - 980131..980499 (+) 369 WP_038828672.1 hypothetical protein -
  K0V03_RS05470 (K0V03_05470) pdeH 980475..981704 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  K0V03_RS05475 (K0V03_05475) pncB 981841..983313 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  K0V03_RS05480 (K0V03_05480) pncA 983329..983880 (-) 552 WP_015714627.1 cysteine hydrolase family protein -
  K0V03_RS05485 (K0V03_05485) yueI 983977..984375 (-) 399 WP_085185940.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=593306 K0V03_RS05455 WP_003220708.1 979529..979669(-) (degQ) [Bacillus subtilis strain HD15]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=593306 K0V03_RS05455 WP_003220708.1 979529..979669(-) (degQ) [Bacillus subtilis strain HD15]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1