Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilO   Type   Machinery gene
Locus tag   KZR01_RS11420 Genome accession   NZ_CP080098
Coordinates   260455..261048 (-) Length   197 a.a.
NCBI ID   WP_005451500.1    Uniprot ID   A0A9X3S2A2
Organism   Vibrio harveyi strain     
Function   type IV pilus biogenesis and function (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 228984..259915 260455..261048 flank 540


Gene organization within MGE regions


Location: 228984..261048
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KZR01_RS11185 - 229831..230118 (-) 288 WP_259556454.1 hypothetical protein -
  KZR01_RS11190 - 230124..230663 (-) 540 WP_259556456.1 hypothetical protein -
  KZR01_RS11195 - 230738..231070 (-) 333 WP_069687511.1 hypothetical protein -
  KZR01_RS11200 - 231096..231326 (-) 231 WP_259556458.1 hypothetical protein -
  KZR01_RS11205 - 231340..231810 (-) 471 WP_259556459.1 hypothetical protein -
  KZR01_RS11210 - 231824..232249 (-) 426 WP_259556460.1 hypothetical protein -
  KZR01_RS11215 - 232614..232766 (-) 153 WP_201258214.1 hypothetical protein -
  KZR01_RS11220 - 232759..232959 (-) 201 WP_050908608.1 hypothetical protein -
  KZR01_RS11225 - 233057..233539 (-) 483 WP_005449720.1 phage structural protein -
  KZR01_RS11230 - 233552..234250 (-) 699 WP_259556463.1 hypothetical protein -
  KZR01_RS11235 - 234253..234435 (-) 183 WP_259556464.1 hypothetical protein -
  KZR01_RS11240 - 234419..234829 (-) 411 WP_259556465.1 hypothetical protein -
  KZR01_RS11245 - 234826..235258 (-) 433 Protein_212 chemotaxis protein -
  KZR01_RS11250 - 235359..235553 (-) 195 WP_259556467.1 hypothetical protein -
  KZR01_RS11255 - 235635..235826 (-) 192 WP_043037031.1 hypothetical protein -
  KZR01_RS11260 - 235828..235953 (-) 126 WP_257887079.1 hypothetical protein -
  KZR01_RS11265 - 235953..236186 (-) 234 WP_259556468.1 hypothetical protein -
  KZR01_RS11270 - 236301..237131 (-) 831 WP_049538370.1 major capsid protein P2 -
  KZR01_RS11275 - 237134..237262 (-) 129 WP_025556568.1 hypothetical protein -
  KZR01_RS11280 - 237388..238137 (-) 750 WP_069687516.1 hypothetical protein -
  KZR01_RS11285 - 238112..238261 (-) 150 WP_259556469.1 hypothetical protein -
  KZR01_RS11290 - 238254..238550 (-) 297 WP_259556470.1 hypothetical protein -
  KZR01_RS11295 - 238543..239052 (-) 510 WP_069687517.1 hypothetical protein -
  KZR01_RS11300 - 239193..239366 (-) 174 WP_259556471.1 hypothetical protein -
  KZR01_RS29035 - 239437..239880 (-) 444 WP_310794945.1 hypothetical protein -
  KZR01_RS29040 - 239864..240178 (-) 315 WP_310794946.1 replication endonuclease -
  KZR01_RS29045 - 240189..240740 (-) 552 WP_310794947.1 replication endonuclease -
  KZR01_RS29050 - 240908..241300 (-) 393 WP_310794948.1 hypothetical protein -
  KZR01_RS11310 - 241303..241545 (-) 243 WP_047517629.1 hypothetical protein -
  KZR01_RS11315 - 241548..241730 (-) 183 WP_025556561.1 hypothetical protein -
  KZR01_RS11320 - 241740..241949 (-) 210 WP_310795028.1 pyocin activator PrtN family protein -
  KZR01_RS11325 - 242129..242770 (+) 642 WP_259556472.1 S24 family peptidase -
  KZR01_RS11330 zur 243129..243584 (+) 456 WP_009697566.1 zinc uptake transcriptional repressor Zur -
  KZR01_RS11335 - 243603..244064 (+) 462 WP_005381269.1 chemotaxis protein CheX -
  KZR01_RS11340 pgi 244165..245817 (-) 1653 WP_033007639.1 glucose-6-phosphate isomerase -
  KZR01_RS11345 - 246124..246543 (+) 420 WP_017819668.1 secondary thiamine-phosphate synthase enzyme YjbQ -
  KZR01_RS11350 - 246595..247791 (-) 1197 WP_005451523.1 BamA/TamA family outer membrane protein -
  KZR01_RS11355 alr 247795..248871 (-) 1077 WP_005451522.1 alanine racemase -
  KZR01_RS11360 - 248885..250285 (-) 1401 WP_005451521.1 replicative DNA helicase -
  KZR01_RS11365 - 250606..251370 (+) 765 WP_009697565.1 DUF481 domain-containing protein -
  KZR01_RS11370 rplI 251449..251901 (-) 453 WP_005451518.1 50S ribosomal protein L9 -
  KZR01_RS11375 rpsR 251934..252161 (-) 228 WP_000090472.1 30S ribosomal protein S18 -
  KZR01_RS11380 rpsF 252450..252830 (-) 381 WP_005451516.1 30S ribosomal protein S6 -
  KZR01_RS11385 rpe 253088..253759 (-) 672 WP_005451514.1 ribulose-phosphate 3-epimerase -
  KZR01_RS11390 - 253859..254698 (-) 840 WP_005451513.1 Dam family site-specific DNA-(adenine-N6)-methyltransferase -
  KZR01_RS29195 - 254768..255349 (-) 582 Protein_245 SPOR domain-containing protein -
  KZR01_RS29200 - 255427..256270 (-) 844 Protein_246 ATP-binding protein -
  KZR01_RS11400 aroB 256324..257424 (-) 1101 WP_038898114.1 3-dehydroquinate synthase -
  KZR01_RS11405 aroK 257456..257974 (-) 519 WP_005451507.1 shikimate kinase AroK -
  KZR01_RS11410 pilQ 258164..259915 (-) 1752 WP_005451505.1 type IV pilus secretin PilQ Machinery gene
  KZR01_RS11415 pilP 259950..260465 (-) 516 WP_005451501.1 pilus assembly protein PilP Machinery gene
  KZR01_RS11420 pilO 260455..261048 (-) 594 WP_005451500.1 type 4a pilus biogenesis protein PilO Machinery gene

Sequence

Protein


Download         Length: 197 a.a.        Molecular weight: 23020.58 Da        Isoelectric Point: 4.8068

>NTDB_id=591065 KZR01_RS11420 WP_005451500.1 260455..261048(-) (pilO) [Vibrio harveyi strain]
MVNWQDLEMDEIAEWPLVPQIVVILLLVVLIQGLGYWFYLKPEQEQLNNLIQEEQTLKVALRIKANKVAALPQLQSQLDE
LTTRYELLLQQLPAQKELATMLASVNELGIDNKLTFTRIDWGDKQSEHFLYRLPLDIELTGDFHDIGRFSQAIATLPRII
TFKDVTWQRVSQESETLHFRVKANTYQFKPEVKKDEK

Nucleotide


Download         Length: 594 bp        

>NTDB_id=591065 KZR01_RS11420 WP_005451500.1 260455..261048(-) (pilO) [Vibrio harveyi strain]
ATGGTTAATTGGCAAGATCTAGAAATGGATGAGATCGCTGAGTGGCCATTGGTGCCTCAGATAGTAGTGATCTTGTTGTT
AGTTGTGCTGATTCAAGGCCTTGGTTATTGGTTTTATTTAAAGCCAGAGCAAGAACAGCTGAATAACCTTATTCAAGAAG
AACAAACCTTAAAAGTTGCGTTACGGATCAAAGCGAACAAAGTCGCTGCTTTGCCTCAATTGCAATCGCAACTTGATGAG
CTTACTACTCGATACGAATTGCTACTGCAACAACTGCCTGCACAGAAAGAGCTGGCAACCATGTTGGCTTCGGTGAATGA
ACTCGGAATTGATAATAAGTTGACGTTCACCCGAATCGACTGGGGTGATAAGCAATCAGAACACTTCCTTTATCGTTTAC
CGCTCGACATTGAGTTGACAGGGGATTTTCATGATATCGGTCGTTTCTCCCAAGCGATTGCGACGTTGCCACGCATCATC
ACTTTTAAAGACGTGACTTGGCAGCGTGTCAGCCAAGAGAGTGAAACTCTGCACTTTCGTGTGAAAGCAAACACTTACCA
GTTCAAACCAGAGGTGAAGAAAGATGAGAAGTAA

Domains

Predicted by InterproScan.

Pilus assembly protein, PilO (PilO)

(47-189)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilO Vibrio campbellii strain DS40M4

93.158

96.447

0.898
  pilO Vibrio cholerae strain A1552

71.066

100

0.711