Detailed information
Overview
| Name | pilP | Type | Machinery gene |
| Locus tag | KZR01_RS11415 | Genome accession | NZ_CP080098 |
| Coordinates | 259950..260465 (-) | Length | 171 a.a. |
| NCBI ID | WP_005451501.1 | Uniprot ID | A0A9X3RXU4 |
| Organism | Vibrio harveyi strain | ||
| Function | type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 228984..259915 | 259950..260465 | flank | 35 |
Gene organization within MGE regions
Location: 228984..260465
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KZR01_RS11185 | - | 229831..230118 (-) | 288 | WP_259556454.1 | hypothetical protein | - |
| KZR01_RS11190 | - | 230124..230663 (-) | 540 | WP_259556456.1 | hypothetical protein | - |
| KZR01_RS11195 | - | 230738..231070 (-) | 333 | WP_069687511.1 | hypothetical protein | - |
| KZR01_RS11200 | - | 231096..231326 (-) | 231 | WP_259556458.1 | hypothetical protein | - |
| KZR01_RS11205 | - | 231340..231810 (-) | 471 | WP_259556459.1 | hypothetical protein | - |
| KZR01_RS11210 | - | 231824..232249 (-) | 426 | WP_259556460.1 | hypothetical protein | - |
| KZR01_RS11215 | - | 232614..232766 (-) | 153 | WP_201258214.1 | hypothetical protein | - |
| KZR01_RS11220 | - | 232759..232959 (-) | 201 | WP_050908608.1 | hypothetical protein | - |
| KZR01_RS11225 | - | 233057..233539 (-) | 483 | WP_005449720.1 | phage structural protein | - |
| KZR01_RS11230 | - | 233552..234250 (-) | 699 | WP_259556463.1 | hypothetical protein | - |
| KZR01_RS11235 | - | 234253..234435 (-) | 183 | WP_259556464.1 | hypothetical protein | - |
| KZR01_RS11240 | - | 234419..234829 (-) | 411 | WP_259556465.1 | hypothetical protein | - |
| KZR01_RS11245 | - | 234826..235258 (-) | 433 | Protein_212 | chemotaxis protein | - |
| KZR01_RS11250 | - | 235359..235553 (-) | 195 | WP_259556467.1 | hypothetical protein | - |
| KZR01_RS11255 | - | 235635..235826 (-) | 192 | WP_043037031.1 | hypothetical protein | - |
| KZR01_RS11260 | - | 235828..235953 (-) | 126 | WP_257887079.1 | hypothetical protein | - |
| KZR01_RS11265 | - | 235953..236186 (-) | 234 | WP_259556468.1 | hypothetical protein | - |
| KZR01_RS11270 | - | 236301..237131 (-) | 831 | WP_049538370.1 | major capsid protein P2 | - |
| KZR01_RS11275 | - | 237134..237262 (-) | 129 | WP_025556568.1 | hypothetical protein | - |
| KZR01_RS11280 | - | 237388..238137 (-) | 750 | WP_069687516.1 | hypothetical protein | - |
| KZR01_RS11285 | - | 238112..238261 (-) | 150 | WP_259556469.1 | hypothetical protein | - |
| KZR01_RS11290 | - | 238254..238550 (-) | 297 | WP_259556470.1 | hypothetical protein | - |
| KZR01_RS11295 | - | 238543..239052 (-) | 510 | WP_069687517.1 | hypothetical protein | - |
| KZR01_RS11300 | - | 239193..239366 (-) | 174 | WP_259556471.1 | hypothetical protein | - |
| KZR01_RS29035 | - | 239437..239880 (-) | 444 | WP_310794945.1 | hypothetical protein | - |
| KZR01_RS29040 | - | 239864..240178 (-) | 315 | WP_310794946.1 | replication endonuclease | - |
| KZR01_RS29045 | - | 240189..240740 (-) | 552 | WP_310794947.1 | replication endonuclease | - |
| KZR01_RS29050 | - | 240908..241300 (-) | 393 | WP_310794948.1 | hypothetical protein | - |
| KZR01_RS11310 | - | 241303..241545 (-) | 243 | WP_047517629.1 | hypothetical protein | - |
| KZR01_RS11315 | - | 241548..241730 (-) | 183 | WP_025556561.1 | hypothetical protein | - |
| KZR01_RS11320 | - | 241740..241949 (-) | 210 | WP_310795028.1 | pyocin activator PrtN family protein | - |
| KZR01_RS11325 | - | 242129..242770 (+) | 642 | WP_259556472.1 | S24 family peptidase | - |
| KZR01_RS11330 | zur | 243129..243584 (+) | 456 | WP_009697566.1 | zinc uptake transcriptional repressor Zur | - |
| KZR01_RS11335 | - | 243603..244064 (+) | 462 | WP_005381269.1 | chemotaxis protein CheX | - |
| KZR01_RS11340 | pgi | 244165..245817 (-) | 1653 | WP_033007639.1 | glucose-6-phosphate isomerase | - |
| KZR01_RS11345 | - | 246124..246543 (+) | 420 | WP_017819668.1 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
| KZR01_RS11350 | - | 246595..247791 (-) | 1197 | WP_005451523.1 | BamA/TamA family outer membrane protein | - |
| KZR01_RS11355 | alr | 247795..248871 (-) | 1077 | WP_005451522.1 | alanine racemase | - |
| KZR01_RS11360 | - | 248885..250285 (-) | 1401 | WP_005451521.1 | replicative DNA helicase | - |
| KZR01_RS11365 | - | 250606..251370 (+) | 765 | WP_009697565.1 | DUF481 domain-containing protein | - |
| KZR01_RS11370 | rplI | 251449..251901 (-) | 453 | WP_005451518.1 | 50S ribosomal protein L9 | - |
| KZR01_RS11375 | rpsR | 251934..252161 (-) | 228 | WP_000090472.1 | 30S ribosomal protein S18 | - |
| KZR01_RS11380 | rpsF | 252450..252830 (-) | 381 | WP_005451516.1 | 30S ribosomal protein S6 | - |
| KZR01_RS11385 | rpe | 253088..253759 (-) | 672 | WP_005451514.1 | ribulose-phosphate 3-epimerase | - |
| KZR01_RS11390 | - | 253859..254698 (-) | 840 | WP_005451513.1 | Dam family site-specific DNA-(adenine-N6)-methyltransferase | - |
| KZR01_RS29195 | - | 254768..255349 (-) | 582 | Protein_245 | SPOR domain-containing protein | - |
| KZR01_RS29200 | - | 255427..256270 (-) | 844 | Protein_246 | ATP-binding protein | - |
| KZR01_RS11400 | aroB | 256324..257424 (-) | 1101 | WP_038898114.1 | 3-dehydroquinate synthase | - |
| KZR01_RS11405 | aroK | 257456..257974 (-) | 519 | WP_005451507.1 | shikimate kinase AroK | - |
| KZR01_RS11410 | pilQ | 258164..259915 (-) | 1752 | WP_005451505.1 | type IV pilus secretin PilQ | Machinery gene |
| KZR01_RS11415 | pilP | 259950..260465 (-) | 516 | WP_005451501.1 | pilus assembly protein PilP | Machinery gene |
Sequence
Protein
Download Length: 171 a.a. Molecular weight: 19142.27 Da Isoelectric Point: 10.1513
>NTDB_id=591064 KZR01_RS11415 WP_005451501.1 259950..260465(-) (pilP) [Vibrio harveyi strain]
MRSKSLLMVCIAGVLTACQANDESLTEFIRDVENQARRDVTKLQPVEEYVVVNYEPEILRAPFELPKEATIATQPVARKD
CWQPPSRKRTGKLERFPLAQLRLKGVMGIGSSVSGLVQAPNGTVYKVKPGQYLGRNNGKVTHVSHNYLLINETLPDGLGC
WQKRKVKLALR
MRSKSLLMVCIAGVLTACQANDESLTEFIRDVENQARRDVTKLQPVEEYVVVNYEPEILRAPFELPKEATIATQPVARKD
CWQPPSRKRTGKLERFPLAQLRLKGVMGIGSSVSGLVQAPNGTVYKVKPGQYLGRNNGKVTHVSHNYLLINETLPDGLGC
WQKRKVKLALR
Nucleotide
Download Length: 516 bp
>NTDB_id=591064 KZR01_RS11415 WP_005451501.1 259950..260465(-) (pilP) [Vibrio harveyi strain]
ATGAGAAGTAAATCTTTGCTGATGGTGTGTATTGCTGGCGTTTTGACTGCCTGCCAAGCCAATGATGAATCACTGACGGA
ATTTATTCGTGACGTGGAGAACCAAGCTCGCCGTGATGTCACCAAACTGCAGCCTGTTGAAGAGTATGTTGTCGTTAATT
ACGAACCCGAAATATTGCGTGCACCTTTCGAATTACCAAAAGAGGCAACGATTGCGACTCAACCTGTTGCAAGAAAAGAC
TGCTGGCAACCTCCTTCAAGAAAGCGAACTGGCAAATTGGAAAGGTTTCCTCTTGCGCAACTGCGCTTGAAGGGTGTGAT
GGGTATCGGCAGCAGTGTTTCTGGGTTGGTTCAGGCTCCGAATGGCACTGTTTACAAAGTAAAACCAGGTCAATACCTCG
GACGCAACAATGGCAAGGTTACCCATGTATCCCACAACTATTTATTGATTAATGAAACCTTGCCAGACGGTTTGGGCTGT
TGGCAAAAACGCAAAGTTAAGTTGGCTTTGAGATAG
ATGAGAAGTAAATCTTTGCTGATGGTGTGTATTGCTGGCGTTTTGACTGCCTGCCAAGCCAATGATGAATCACTGACGGA
ATTTATTCGTGACGTGGAGAACCAAGCTCGCCGTGATGTCACCAAACTGCAGCCTGTTGAAGAGTATGTTGTCGTTAATT
ACGAACCCGAAATATTGCGTGCACCTTTCGAATTACCAAAAGAGGCAACGATTGCGACTCAACCTGTTGCAAGAAAAGAC
TGCTGGCAACCTCCTTCAAGAAAGCGAACTGGCAAATTGGAAAGGTTTCCTCTTGCGCAACTGCGCTTGAAGGGTGTGAT
GGGTATCGGCAGCAGTGTTTCTGGGTTGGTTCAGGCTCCGAATGGCACTGTTTACAAAGTAAAACCAGGTCAATACCTCG
GACGCAACAATGGCAAGGTTACCCATGTATCCCACAACTATTTATTGATTAATGAAACCTTGCCAGACGGTTTGGGCTGT
TGGCAAAAACGCAAAGTTAAGTTGGCTTTGAGATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilP | Vibrio campbellii strain DS40M4 |
90.058 |
100 |
0.901 |
| pilP | Vibrio cholerae strain A1552 |
59.494 |
92.398 |
0.55 |