Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   KYI08_RS08620 Genome accession   NZ_CP079950
Coordinates   1646941..1647423 (-) Length   160 a.a.
NCBI ID   WP_143935808.1    Uniprot ID   -
Organism   Macrococcoides caseolyticum strain 19Msa0287     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1616143..1656179 1646941..1647423 within 0


Gene organization within MGE regions


Location: 1616143..1656179
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KYI08_RS08405 (KYI08_08405) - 1616143..1617048 (-) 906 WP_219508793.1 N-acetylmuramoyl-L-alanine amidase family protein -
  KYI08_RS08410 (KYI08_08410) - 1617051..1617317 (-) 267 WP_219508803.1 phage holin -
  KYI08_RS08415 (KYI08_08415) - 1617394..1618356 (-) 963 WP_219508805.1 family 20 glycosylhydrolase -
  KYI08_RS08420 (KYI08_08420) - 1618396..1618683 (-) 288 WP_101041667.1 hypothetical protein -
  KYI08_RS08430 (KYI08_08430) - 1619077..1619772 (-) 696 WP_219508807.1 hypothetical protein -
  KYI08_RS08435 (KYI08_08435) - 1619921..1621903 (-) 1983 WP_219508809.1 glycoside hydrolase family 55 protein -
  KYI08_RS08440 (KYI08_08440) - 1621890..1622174 (-) 285 WP_219508811.1 hypothetical protein -
  KYI08_RS08445 (KYI08_08445) - 1622185..1623960 (-) 1776 WP_219508814.1 phage tail spike protein -
  KYI08_RS08450 (KYI08_08450) - 1623960..1624397 (-) 438 WP_101152185.1 hypothetical protein -
  KYI08_RS08455 (KYI08_08455) - 1624394..1630969 (-) 6576 WP_219508817.1 phage tail tape measure protein -
  KYI08_RS08460 (KYI08_08460) - 1631015..1631188 (-) 174 WP_157820008.1 hypothetical protein -
  KYI08_RS08465 (KYI08_08465) gpG 1631233..1631646 (-) 414 WP_101035812.1 phage tail assembly chaperone G -
  KYI08_RS08470 (KYI08_08470) - 1631709..1631927 (-) 219 WP_219508825.1 hypothetical protein -
  KYI08_RS08475 (KYI08_08475) - 1631947..1632582 (-) 636 WP_101057192.1 major tail protein -
  KYI08_RS08480 (KYI08_08480) - 1632602..1632997 (-) 396 WP_101030818.1 hypothetical protein -
  KYI08_RS08485 (KYI08_08485) - 1632990..1633367 (-) 378 WP_219508827.1 HK97-gp10 family putative phage morphogenesis protein -
  KYI08_RS08490 (KYI08_08490) - 1633364..1633705 (-) 342 WP_157821454.1 phage head closure protein -
  KYI08_RS08495 (KYI08_08495) - 1633692..1634012 (-) 321 WP_101144681.1 head-tail connector protein -
  KYI08_RS08500 (KYI08_08500) - 1634025..1635143 (-) 1119 WP_101057189.1 phage major capsid protein -
  KYI08_RS08505 (KYI08_08505) - 1635274..1635960 (-) 687 WP_257710248.1 head maturation protease, ClpP-related -
  KYI08_RS08510 (KYI08_08510) - 1635950..1637203 (-) 1254 WP_101143676.1 phage portal protein -
  KYI08_RS08515 (KYI08_08515) - 1637208..1637378 (-) 171 WP_157820206.1 hypothetical protein -
  KYI08_RS08520 (KYI08_08520) - 1637390..1639084 (-) 1695 WP_219508829.1 terminase large subunit -
  KYI08_RS08525 (KYI08_08525) - 1639084..1639596 (-) 513 WP_101037438.1 phage terminase small subunit P27 family -
  KYI08_RS08530 (KYI08_08530) - 1639714..1640562 (-) 849 WP_219508847.1 HNH endonuclease -
  KYI08_RS08535 (KYI08_08535) - 1640713..1641177 (-) 465 WP_219508849.1 hypothetical protein -
  KYI08_RS08540 (KYI08_08540) - 1641398..1641595 (-) 198 WP_157821368.1 hypothetical protein -
  KYI08_RS08545 (KYI08_08545) - 1641630..1642178 (-) 549 WP_101175971.1 site-specific integrase -
  KYI08_RS08550 (KYI08_08550) - 1642178..1642627 (-) 450 WP_101152002.1 ArpU family phage packaging/lysis transcriptional regulator -
  KYI08_RS08555 (KYI08_08555) - 1642699..1642911 (-) 213 WP_101035828.1 hypothetical protein -
  KYI08_RS08560 (KYI08_08560) - 1642915..1643172 (-) 258 WP_219508852.1 hypothetical protein -
  KYI08_RS08565 (KYI08_08565) - 1643165..1643482 (-) 318 WP_257710253.1 hypothetical protein -
  KYI08_RS08570 (KYI08_08570) - 1643475..1643858 (-) 384 WP_219508854.1 hypothetical protein -
  KYI08_RS08575 (KYI08_08575) - 1643879..1644091 (-) 213 WP_101143669.1 hypothetical protein -
  KYI08_RS08580 (KYI08_08580) - 1644112..1644414 (-) 303 WP_219508855.1 hypothetical protein -
  KYI08_RS08585 (KYI08_08585) - 1644438..1644641 (-) 204 WP_219508857.1 hypothetical protein -
  KYI08_RS08590 (KYI08_08590) - 1644655..1644807 (-) 153 WP_157821177.1 hypothetical protein -
  KYI08_RS08595 (KYI08_08595) - 1644818..1645330 (-) 513 WP_101144217.1 Holliday junction resolvase RecU -
  KYI08_RS12490 - 1645525..1646058 (-) 534 WP_257710256.1 MazG-like family protein -
  KYI08_RS08605 (KYI08_08605) - 1646072..1646314 (-) 243 WP_219508871.1 hypothetical protein -
  KYI08_RS08610 (KYI08_08610) - 1646327..1646575 (-) 249 WP_101035836.1 hypothetical protein -
  KYI08_RS08615 (KYI08_08615) - 1646586..1646927 (-) 342 WP_219508873.1 hypothetical protein -
  KYI08_RS08620 (KYI08_08620) ssbA 1646941..1647423 (-) 483 WP_143935808.1 single-stranded DNA-binding protein Machinery gene
  KYI08_RS08625 (KYI08_08625) - 1647413..1647742 (-) 330 WP_086038606.1 hypothetical protein -
  KYI08_RS08630 (KYI08_08630) - 1647834..1648034 (+) 201 WP_086038605.1 hypothetical protein -
  KYI08_RS08635 (KYI08_08635) - 1648216..1648416 (+) 201 WP_086038604.1 hypothetical protein -
  KYI08_RS08640 (KYI08_08640) - 1648391..1648582 (-) 192 WP_219509217.1 hypothetical protein -
  KYI08_RS08645 (KYI08_08645) - 1648584..1648874 (-) 291 WP_219508875.1 hypothetical protein -
  KYI08_RS08650 (KYI08_08650) - 1648878..1649063 (-) 186 WP_101035841.1 DUF6877 family protein -
  KYI08_RS08655 (KYI08_08655) - 1649076..1649984 (-) 909 WP_101035842.1 helix-turn-helix domain-containing protein -
  KYI08_RS08660 (KYI08_08660) - 1649997..1650263 (-) 267 WP_219508877.1 hypothetical protein -
  KYI08_RS08665 (KYI08_08665) - 1650253..1651005 (-) 753 WP_198550077.1 BRO family protein -
  KYI08_RS08670 (KYI08_08670) - 1651098..1651286 (-) 189 WP_219508879.1 hypothetical protein -
  KYI08_RS08675 (KYI08_08675) - 1651325..1651522 (-) 198 WP_101142797.1 hypothetical protein -
  KYI08_RS08680 (KYI08_08680) - 1651571..1651771 (-) 201 WP_101140176.1 helix-turn-helix transcriptional regulator -
  KYI08_RS08685 (KYI08_08685) - 1651927..1652328 (+) 402 WP_101140175.1 helix-turn-helix domain-containing protein -
  KYI08_RS08690 (KYI08_08690) - 1652342..1652767 (+) 426 WP_101171177.1 ImmA/IrrE family metallo-endopeptidase -
  KYI08_RS08695 (KYI08_08695) - 1652819..1653517 (+) 699 WP_232779627.1 PH domain-containing protein -
  KYI08_RS08700 (KYI08_08700) - 1653536..1654000 (+) 465 WP_101176025.1 hypothetical protein -
  KYI08_RS08705 (KYI08_08705) - 1654043..1654309 (+) 267 WP_101176027.1 hypothetical protein -
  KYI08_RS08710 (KYI08_08710) - 1654333..1654869 (+) 537 WP_219508881.1 hypothetical protein -
  KYI08_RS08715 (KYI08_08715) - 1654986..1656179 (+) 1194 WP_198552089.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 18007.91 Da        Isoelectric Point: 5.0189

>NTDB_id=590519 KYI08_RS08620 WP_143935808.1 1646941..1647423(-) (ssbA) [Macrococcoides caseolyticum strain 19Msa0287]
MLNRVVLVGRLTKDPEYRVTQSGIAVASFTLAVNRTFTNAQGERQADFINCIVFRKQADNVNTYLHKGSLAGVDGRLQSR
SYENQEGRRVFVTEVVCESVQFLEPKNSRNGADHYEDYPQAQKTNDYAEREKKAQETMPGNNPFANADGPIDISDDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=590519 KYI08_RS08620 WP_143935808.1 1646941..1647423(-) (ssbA) [Macrococcoides caseolyticum strain 19Msa0287]
ATGTTAAATAGAGTAGTCCTAGTAGGACGTTTAACAAAGGATCCTGAATATCGAGTTACTCAGTCTGGAATAGCTGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTCACTAATGCACAAGGCGAGCGACAAGCAGACTTTATAAATTGTATCGTAT
TCAGAAAGCAAGCAGACAACGTAAATACTTATCTGCATAAAGGTAGCTTAGCTGGTGTAGATGGCAGATTACAATCACGT
AGCTATGAGAATCAAGAAGGCAGACGAGTATTCGTAACTGAAGTTGTATGTGAATCAGTCCAATTCCTAGAACCGAAGAA
TTCAAGAAATGGTGCAGATCACTATGAAGATTATCCGCAAGCACAAAAAACAAATGATTATGCAGAACGAGAGAAAAAGG
CACAGGAGACAATGCCAGGTAATAATCCCTTTGCTAATGCCGATGGGCCAATAGATATTAGCGATGACGATTTACCGTTT
TAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

59.302

100

0.637
  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.537
  ssbB Bacillus subtilis subsp. subtilis str. 168

57.522

70.625

0.406