Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KXZ66_RS16395 Genome accession   NZ_CP079759
Coordinates   3163805..3163945 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. LJBS17     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3158805..3168945
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KXZ66_RS16370 (KXZ66_16365) - 3159117..3159497 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  KXZ66_RS16375 (KXZ66_16370) comA 3159516..3160160 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KXZ66_RS16380 (KXZ66_16375) comP 3160241..3162551 (-) 2311 Protein_3187 two-component system sensor histidine kinase ComP -
  KXZ66_RS16385 (KXZ66_16380) comX 3162566..3162733 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  KXZ66_RS16390 (KXZ66_16385) comQ 3162721..3163620 (-) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  KXZ66_RS16395 (KXZ66_16390) degQ 3163805..3163945 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KXZ66_RS22655 - 3164167..3164229 (+) 63 Protein_3191 hypothetical protein -
  KXZ66_RS16400 (KXZ66_16395) - 3164407..3164775 (+) 369 WP_038828672.1 hypothetical protein -
  KXZ66_RS16405 (KXZ66_16400) pdeH 3164751..3165980 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KXZ66_RS16410 (KXZ66_16405) - 3166117..3167589 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KXZ66_RS16415 (KXZ66_16410) - 3167605..3168156 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  KXZ66_RS16420 (KXZ66_16415) - 3168253..3168651 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=589345 KXZ66_RS16395 WP_003220708.1 3163805..3163945(-) (degQ) [Bacillus sp. LJBS17]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=589345 KXZ66_RS16395 WP_003220708.1 3163805..3163945(-) (degQ) [Bacillus sp. LJBS17]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1