Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   KXZ66_RS12985 Genome accession   NZ_CP079759
Coordinates   2515753..2516136 (-) Length   127 a.a.
NCBI ID   WP_031315212.1    Uniprot ID   -
Organism   Bacillus sp. LJBS17     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2510753..2521136
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KXZ66_RS12945 (KXZ66_12940) sinI 2511686..2511859 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  KXZ66_RS12950 (KXZ66_12945) sinR 2511893..2512228 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KXZ66_RS12955 (KXZ66_12950) tasA 2512321..2513106 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  KXZ66_RS12960 (KXZ66_12955) sipW 2513171..2513743 (-) 573 WP_003246088.1 signal peptidase I SipW -
  KXZ66_RS12965 (KXZ66_12960) tapA 2513727..2514488 (-) 762 WP_077671431.1 amyloid fiber anchoring/assembly protein TapA -
  KXZ66_RS12970 (KXZ66_12965) - 2514759..2515085 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  KXZ66_RS12975 (KXZ66_12970) - 2515127..2515306 (-) 180 WP_014480252.1 YqzE family protein -
  KXZ66_RS12980 (KXZ66_12975) comGG 2515378..2515752 (-) 375 WP_021480019.1 ComG operon protein ComGG Machinery gene
  KXZ66_RS12985 (KXZ66_12980) comGF 2515753..2516136 (-) 384 WP_031315212.1 ComG operon protein ComGF Machinery gene
  KXZ66_RS12990 (KXZ66_12985) comGE 2516162..2516509 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  KXZ66_RS12995 (KXZ66_12990) comGD 2516493..2516924 (-) 432 WP_021480021.1 comG operon protein ComGD Machinery gene
  KXZ66_RS13000 (KXZ66_12995) comGC 2516914..2517210 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  KXZ66_RS13005 (KXZ66_13000) comGB 2517224..2518261 (-) 1038 WP_021480022.1 comG operon protein ComGB Machinery gene
  KXZ66_RS13010 (KXZ66_13005) comGA 2518248..2519318 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KXZ66_RS22600 - 2519607..2519744 (-) 138 WP_021480024.1 hypothetical protein -
  KXZ66_RS13020 (KXZ66_13015) corA 2519746..2520699 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=589323 KXZ66_RS12985 WP_031315212.1 2515753..2516136(-) (comGF) [Bacillus sp. LJBS17]
MLISGSLAAIFHLFLSRQQEHEGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=589323 KXZ66_RS12985 WP_031315212.1 2515753..2516136(-) (comGF) [Bacillus sp. LJBS17]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGAGGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984