Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KXZ66_RS12945 Genome accession   NZ_CP079759
Coordinates   2511686..2511859 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus sp. LJBS17     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2506686..2516859
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KXZ66_RS12930 (KXZ66_12925) gcvT 2507484..2508572 (-) 1089 WP_021480013.1 glycine cleavage system aminomethyltransferase GcvT -
  KXZ66_RS12935 (KXZ66_12930) - 2509014..2510687 (+) 1674 WP_038829735.1 DEAD/DEAH box helicase -
  KXZ66_RS12940 (KXZ66_12935) - 2510708..2511502 (+) 795 WP_021480015.1 YqhG family protein -
  KXZ66_RS12945 (KXZ66_12940) sinI 2511686..2511859 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  KXZ66_RS12950 (KXZ66_12945) sinR 2511893..2512228 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KXZ66_RS12955 (KXZ66_12950) tasA 2512321..2513106 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  KXZ66_RS12960 (KXZ66_12955) sipW 2513171..2513743 (-) 573 WP_003246088.1 signal peptidase I SipW -
  KXZ66_RS12965 (KXZ66_12960) tapA 2513727..2514488 (-) 762 WP_077671431.1 amyloid fiber anchoring/assembly protein TapA -
  KXZ66_RS12970 (KXZ66_12965) - 2514759..2515085 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  KXZ66_RS12975 (KXZ66_12970) - 2515127..2515306 (-) 180 WP_014480252.1 YqzE family protein -
  KXZ66_RS12980 (KXZ66_12975) comGG 2515378..2515752 (-) 375 WP_021480019.1 ComG operon protein ComGG Machinery gene
  KXZ66_RS12985 (KXZ66_12980) comGF 2515753..2516136 (-) 384 WP_031315212.1 ComG operon protein ComGF Machinery gene
  KXZ66_RS12990 (KXZ66_12985) comGE 2516162..2516509 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=589320 KXZ66_RS12945 WP_014477323.1 2511686..2511859(+) (sinI) [Bacillus sp. LJBS17]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=589320 KXZ66_RS12945 WP_014477323.1 2511686..2511859(+) (sinI) [Bacillus sp. LJBS17]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982