Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   KVY05_RS13265 Genome accession   NZ_CP079099
Coordinates   2668428..2668865 (-) Length   145 a.a.
NCBI ID   WP_015240210.1    Uniprot ID   -
Organism   Bacillus velezensis strain LBY-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2663428..2673865
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KVY05_RS13215 (KVY05_13215) sinI 2663812..2663985 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KVY05_RS13220 (KVY05_13220) sinR 2664019..2664354 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KVY05_RS13225 (KVY05_13225) tasA 2664402..2665187 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KVY05_RS13230 (KVY05_13230) sipW 2665252..2665836 (-) 585 WP_015240205.1 signal peptidase I SipW -
  KVY05_RS13235 (KVY05_13235) tapA 2665808..2666479 (-) 672 WP_124692843.1 amyloid fiber anchoring/assembly protein TapA -
  KVY05_RS13240 (KVY05_13240) - 2666738..2667067 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  KVY05_RS13245 (KVY05_13245) - 2667107..2667286 (-) 180 WP_003153093.1 YqzE family protein -
  KVY05_RS13250 (KVY05_13250) comGG 2667343..2667720 (-) 378 WP_015240208.1 competence type IV pilus minor pilin ComGG Machinery gene
  KVY05_RS13255 (KVY05_13255) comGF 2667721..2668221 (-) 501 WP_256994853.1 competence type IV pilus minor pilin ComGF -
  KVY05_RS13260 (KVY05_13260) comGE 2668130..2668444 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  KVY05_RS13265 (KVY05_13265) comGD 2668428..2668865 (-) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene
  KVY05_RS13270 (KVY05_13270) comGC 2668855..2669163 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KVY05_RS13275 (KVY05_13275) comGB 2669168..2670205 (-) 1038 WP_218791295.1 competence type IV pilus assembly protein ComGB Machinery gene
  KVY05_RS13280 (KVY05_13280) comGA 2670192..2671262 (-) 1071 WP_124692840.1 competence type IV pilus ATPase ComGA Machinery gene
  KVY05_RS13285 (KVY05_13285) - 2671455..2672405 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  KVY05_RS13290 (KVY05_13290) - 2672551..2673852 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16272.75 Da        Isoelectric Point: 10.2186

>NTDB_id=587748 KVY05_RS13265 WP_015240210.1 2668428..2668865(-) (comGD) [Bacillus velezensis strain LBY-1]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGKILERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=587748 KVY05_RS13265 WP_015240210.1 2668428..2668865(-) (comGD) [Bacillus velezensis strain LBY-1]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAGCAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAAGATTCTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTTCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572