Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   KVY05_RS13250 Genome accession   NZ_CP079099
Coordinates   2667343..2667720 (-) Length   125 a.a.
NCBI ID   WP_015240208.1    Uniprot ID   -
Organism   Bacillus velezensis strain LBY-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2662343..2672720
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KVY05_RS13210 (KVY05_13210) - 2662841..2663635 (+) 795 WP_208480294.1 YqhG family protein -
  KVY05_RS13215 (KVY05_13215) sinI 2663812..2663985 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KVY05_RS13220 (KVY05_13220) sinR 2664019..2664354 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KVY05_RS13225 (KVY05_13225) tasA 2664402..2665187 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KVY05_RS13230 (KVY05_13230) sipW 2665252..2665836 (-) 585 WP_015240205.1 signal peptidase I SipW -
  KVY05_RS13235 (KVY05_13235) tapA 2665808..2666479 (-) 672 WP_124692843.1 amyloid fiber anchoring/assembly protein TapA -
  KVY05_RS13240 (KVY05_13240) - 2666738..2667067 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  KVY05_RS13245 (KVY05_13245) - 2667107..2667286 (-) 180 WP_003153093.1 YqzE family protein -
  KVY05_RS13250 (KVY05_13250) comGG 2667343..2667720 (-) 378 WP_015240208.1 competence type IV pilus minor pilin ComGG Machinery gene
  KVY05_RS13255 (KVY05_13255) comGF 2667721..2668221 (-) 501 WP_256994853.1 competence type IV pilus minor pilin ComGF -
  KVY05_RS13260 (KVY05_13260) comGE 2668130..2668444 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  KVY05_RS13265 (KVY05_13265) comGD 2668428..2668865 (-) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene
  KVY05_RS13270 (KVY05_13270) comGC 2668855..2669163 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KVY05_RS13275 (KVY05_13275) comGB 2669168..2670205 (-) 1038 WP_218791295.1 competence type IV pilus assembly protein ComGB Machinery gene
  KVY05_RS13280 (KVY05_13280) comGA 2670192..2671262 (-) 1071 WP_124692840.1 competence type IV pilus ATPase ComGA Machinery gene
  KVY05_RS13285 (KVY05_13285) - 2671455..2672405 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14123.08 Da        Isoelectric Point: 9.9599

>NTDB_id=587747 KVY05_RS13250 WP_015240208.1 2667343..2667720(-) (comGG) [Bacillus velezensis strain LBY-1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRRGAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=587747 KVY05_RS13250 WP_015240208.1 2667343..2667720(-) (comGG) [Bacillus velezensis strain LBY-1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACCGGAACGAGACGGGG
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512