Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KVY05_RS13215 | Genome accession | NZ_CP079099 |
| Coordinates | 2663812..2663985 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain LBY-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2658812..2668985
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KVY05_RS13200 (KVY05_13200) | gcvT | 2659625..2660725 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KVY05_RS13205 (KVY05_13205) | - | 2661149..2662819 (+) | 1671 | WP_132105375.1 | DEAD/DEAH box helicase | - |
| KVY05_RS13210 (KVY05_13210) | - | 2662841..2663635 (+) | 795 | WP_208480294.1 | YqhG family protein | - |
| KVY05_RS13215 (KVY05_13215) | sinI | 2663812..2663985 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| KVY05_RS13220 (KVY05_13220) | sinR | 2664019..2664354 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| KVY05_RS13225 (KVY05_13225) | tasA | 2664402..2665187 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| KVY05_RS13230 (KVY05_13230) | sipW | 2665252..2665836 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| KVY05_RS13235 (KVY05_13235) | tapA | 2665808..2666479 (-) | 672 | WP_124692843.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KVY05_RS13240 (KVY05_13240) | - | 2666738..2667067 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| KVY05_RS13245 (KVY05_13245) | - | 2667107..2667286 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| KVY05_RS13250 (KVY05_13250) | comGG | 2667343..2667720 (-) | 378 | WP_015240208.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KVY05_RS13255 (KVY05_13255) | comGF | 2667721..2668221 (-) | 501 | WP_256994853.1 | competence type IV pilus minor pilin ComGF | - |
| KVY05_RS13260 (KVY05_13260) | comGE | 2668130..2668444 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| KVY05_RS13265 (KVY05_13265) | comGD | 2668428..2668865 (-) | 438 | WP_015240210.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=587745 KVY05_RS13215 WP_003153105.1 2663812..2663985(+) (sinI) [Bacillus velezensis strain LBY-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=587745 KVY05_RS13215 WP_003153105.1 2663812..2663985(+) (sinI) [Bacillus velezensis strain LBY-1]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |