Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   K750_RS07760 Genome accession   NC_021217
Coordinates   1600896..1601009 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori UM037     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1595896..1606009
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K750_RS07735 (K750_00020) - 1595949..1598174 (+) 2226 WP_021299548.1 AAA family ATPase -
  K750_RS07740 (K750_00015) panD 1598164..1598517 (+) 354 WP_000142235.1 aspartate 1-decarboxylase -
  K750_RS07745 (K750_00010) - 1598520..1598822 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  K750_RS07750 (K750_00005) - 1598822..1599817 (+) 996 WP_015643461.1 PDZ domain-containing protein -
  K750_RS07755 (K750_09110) comB6 1599825..1600880 (+) 1056 WP_015644758.1 P-type conjugative transfer protein TrbL Machinery gene
  K750_RS07760 (K750_09115) comB7 1600896..1601009 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  K750_RS07765 (K750_09120) comB8 1601006..1601749 (+) 744 WP_015644757.1 type IV secretion system protein Machinery gene
  K750_RS07770 (K750_09125) comB9 1601749..1602723 (+) 975 WP_015644756.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  K750_RS07775 (K750_09130) comB10 1602716..1603852 (+) 1137 WP_015644755.1 DNA type IV secretion system protein ComB10 Machinery gene
  K750_RS07780 (K750_09135) - 1603922..1605334 (+) 1413 WP_015644754.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=58728 K750_RS07760 WP_001217873.1 1600896..1601009(+) (comB7) [Helicobacter pylori UM037]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=58728 K750_RS07760 WP_001217873.1 1600896..1601009(+) (comB7) [Helicobacter pylori UM037]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment