Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilI   Type   Machinery gene
Locus tag   KWY96_RS05510 Genome accession   NZ_CP078116
Coordinates   1067539..1068156 (-) Length   205 a.a.
NCBI ID   WP_010359918.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 88G285     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1026726..1075958 1067539..1068156 within 0


Gene organization within MGE regions


Location: 1026726..1075958
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KWY96_RS05235 (KWY96_05235) - 1026726..1027577 (+) 852 WP_003695018.1 Bro-N domain-containing protein -
  KWY96_RS05240 (KWY96_05240) - 1027763..1028437 (-) 675 WP_003695013.1 hypothetical protein -
  KWY96_RS05245 (KWY96_05245) - 1028434..1028919 (-) 486 WP_003687997.1 hypothetical protein -
  KWY96_RS05250 (KWY96_05250) - 1028925..1029398 (-) 474 WP_003687996.1 hypothetical protein -
  KWY96_RS05255 (KWY96_05255) - 1029453..1030748 (-) 1296 WP_003695011.1 DUF4043 family protein -
  KWY96_RS05260 (KWY96_05260) - 1031374..1038635 (-) 7262 Protein_1029 PLxRFG domain-containing protein -
  KWY96_RS11580 - 1038632..1038856 (-) 225 WP_256347173.1 hypothetical protein -
  KWY96_RS05270 (KWY96_05270) - 1038914..1039828 (-) 915 WP_256347174.1 hypothetical protein -
  KWY96_RS05275 (KWY96_05275) - 1040065..1042332 (-) 2268 WP_229692682.1 hypothetical protein -
  KWY96_RS05280 (KWY96_05280) - 1042317..1043591 (-) 1275 WP_003695006.1 PBSX family phage terminase large subunit -
  KWY96_RS11585 - 1043572..1044111 (-) 540 WP_003690920.1 hypothetical protein -
  KWY96_RS05295 (KWY96_05295) - 1044111..1044533 (-) 423 WP_003690919.1 hypothetical protein -
  KWY96_RS05300 (KWY96_05300) - 1044598..1045116 (-) 519 WP_003687984.1 HNH endonuclease -
  KWY96_RS05305 (KWY96_05305) - 1045107..1045490 (-) 384 WP_003690918.1 recombination protein NinB -
  KWY96_RS05310 (KWY96_05310) - 1045487..1045792 (-) 306 WP_003687981.1 nuclease domain-containing protein -
  KWY96_RS05315 (KWY96_05315) - 1045785..1046222 (-) 438 WP_123794336.1 RusA family crossover junction endodeoxyribonuclease -
  KWY96_RS11590 - 1046213..1046494 (-) 282 WP_003689109.1 hypothetical protein -
  KWY96_RS05320 (KWY96_05320) - 1046523..1046672 (-) 150 WP_003689110.1 hypothetical protein -
  KWY96_RS05325 (KWY96_05325) - 1046849..1047343 (-) 495 WP_041421248.1 DUF3310 domain-containing protein -
  KWY96_RS05330 (KWY96_05330) - 1047382..1047645 (-) 264 WP_218422957.1 hypothetical protein -
  KWY96_RS05335 (KWY96_05335) - 1047682..1049043 (-) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  KWY96_RS11845 (KWY96_05340) - 1049040..1050104 (-) 1065 WP_003693470.1 hypothetical protein -
  KWY96_RS05345 (KWY96_05345) - 1050222..1050449 (-) 228 WP_050158909.1 helix-turn-helix domain-containing protein -
  KWY96_RS05350 (KWY96_05350) - 1050622..1050810 (+) 189 WP_050157615.1 hypothetical protein -
  KWY96_RS05355 (KWY96_05355) - 1050787..1050942 (-) 156 WP_003698902.1 hypothetical protein -
  KWY96_RS05360 (KWY96_05360) - 1051022..1051258 (-) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  KWY96_RS05365 (KWY96_05365) - 1051381..1052043 (+) 663 WP_012503489.1 LexA family transcriptional regulator -
  KWY96_RS05370 (KWY96_05370) - 1052156..1052593 (+) 438 WP_003687967.1 hypothetical protein -
  KWY96_RS05375 (KWY96_05375) - 1052610..1053071 (+) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  KWY96_RS05380 (KWY96_05380) - 1053068..1053481 (+) 414 WP_003687963.1 hypothetical protein -
  KWY96_RS05385 (KWY96_05385) - 1053679..1053879 (+) 201 WP_047920246.1 hypothetical protein -
  KWY96_RS05390 (KWY96_05390) - 1053912..1054388 (+) 477 WP_002255718.1 hypothetical protein -
  KWY96_RS05395 (KWY96_05395) - 1054385..1054672 (+) 288 WP_218422916.1 hypothetical protein -
  KWY96_RS05400 (KWY96_05400) - 1054813..1055145 (+) 333 WP_033910331.1 phage associated protein -
  KWY96_RS05405 (KWY96_05405) - 1055298..1055573 (+) 276 WP_048654501.1 NGO1622 family putative holin -
  KWY96_RS05410 (KWY96_05410) - 1055570..1055731 (+) 162 WP_003691530.1 hypothetical protein -
  KWY96_RS05415 (KWY96_05415) - 1055800..1056486 (+) 687 WP_010357532.1 phage replication initiation protein, NGO0469 family -
  KWY96_RS05420 (KWY96_05420) - 1056626..1056808 (+) 183 WP_004464808.1 hypothetical protein -
  KWY96_RS05425 (KWY96_05425) - 1056805..1057296 (+) 492 WP_047916888.1 siphovirus Gp157 family protein -
  KWY96_RS05430 (KWY96_05430) - 1057348..1057563 (+) 216 WP_003691538.1 hypothetical protein -
  KWY96_RS11850 - 1057674..1057907 (+) 234 Protein_1064 hypothetical protein -
  KWY96_RS05440 (KWY96_05440) - 1058221..1058904 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  KWY96_RS05445 (KWY96_05445) - 1059099..1059368 (+) 270 WP_003687928.1 hypothetical protein -
  KWY96_RS05455 (KWY96_05455) - 1059724..1060924 (-) 1201 Protein_1067 tyrosine-type recombinase/integrase -
  KWY96_RS05470 (KWY96_05470) yaaA 1061454..1062233 (-) 780 WP_003687925.1 peroxide stress protein YaaA -
  KWY96_RS05475 (KWY96_05475) dapC 1062544..1063731 (-) 1188 WP_003687924.1 succinyldiaminopimelate transaminase -
  KWY96_RS05480 (KWY96_05480) dut 1063809..1064261 (-) 453 WP_003687923.1 dUTP diphosphatase -
  KWY96_RS05485 (KWY96_05485) - 1064427..1065134 (+) 708 Protein_1071 AzlC family ABC transporter permease -
  KWY96_RS05490 (KWY96_05490) - 1065131..1065439 (+) 309 WP_010951048.1 AzlD family protein -
  KWY96_RS05495 (KWY96_05495) pilL 1065509..1065982 (-) 474 WP_218422965.1 PilX family type IV pilin Machinery gene
  KWY96_RS05500 (KWY96_05500) pilK 1065984..1066595 (-) 612 WP_218422958.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  KWY96_RS05505 (KWY96_05505) pilJ 1066574..1067542 (-) 969 WP_010359920.1 PilW family protein Machinery gene
  KWY96_RS05510 (KWY96_05510) pilI 1067539..1068156 (-) 618 WP_010359918.1 type IV pilus modification protein PilV Machinery gene
  KWY96_RS05515 (KWY96_05515) pilH 1068188..1068850 (-) 663 WP_025455984.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  KWY96_RS05520 (KWY96_05520) dnaB 1069158..1070564 (-) 1407 WP_003701055.1 replicative DNA helicase -
  KWY96_RS05525 (KWY96_05525) - 1070728..1071309 (+) 582 WP_003698180.1 superoxide dismutase -
  KWY96_RS05530 (KWY96_05530) - 1071539..1072048 (-) 510 WP_218422959.1 isoprenylcysteine carboxyl methyltransferase family protein -
  KWY96_RS05535 (KWY96_05535) - 1072375..1072707 (-) 333 WP_003687908.1 hypothetical protein -
  KWY96_RS05540 (KWY96_05540) cysT 1072893..1073731 (+) 839 Protein_1082 sulfate ABC transporter permease subunit CysT -
  KWY96_RS05545 (KWY96_05545) cysW 1073920..1074741 (+) 822 WP_082298537.1 sulfate ABC transporter permease subunit CysW -
  KWY96_RS05550 (KWY96_05550) - 1074737..1074844 (+) 108 Protein_1084 IS5/IS1182 family transposase -
  KWY96_RS05555 (KWY96_05555) - 1074882..1075958 (+) 1077 WP_003701047.1 sulfate/molybdate ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 205 a.a.        Molecular weight: 22132.98 Da        Isoelectric Point: 4.9758

>NTDB_id=586976 KWY96_RS05510 WP_010359918.1 1067539..1068156(-) (pilI) [Neisseria gonorrhoeae strain 88G285]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYTGPYTPTPSGGDFKFNNNNLISKKDLAKAQLDRFGYELKQALPDAVAIHHAVCKDSSGDAPTLSDSGDFSSNCDDK
ANGDTLIKVLWVNDSAGDSDISRTNLGVSGGNIVYTYQARVGGRE

Nucleotide


Download         Length: 618 bp        

>NTDB_id=586976 KWY96_RS05510 WP_010359918.1 1067539..1068156(-) (pilI) [Neisseria gonorrhoeae strain 88G285]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTACAGTTGCGGACAGTCGCTTCCGTCAGGGAGGCGGAGACACAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACACGGGGCCGTACACCCCCACTCCCTCTGGCGGCGATTTCAAGTTTAATAATAATAATTTGATAAGTAA
GAAGGATTTGGCAAAAGCCCAGTTGGACAGGTTCGGTTATGAATTGAAACAAGCCTTGCCGGATGCGGTAGCTATTCATC
ACGCCGTCTGCAAGGATTCGTCGGGTGACGCGCCGACATTGTCCGACAGCGGTGATTTTTCTTCAAATTGCGACGATAAG
GCAAACGGGGATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGG
GGTGAGCGGCGGCAATATCGTATATACTTATCAGGCAAGGGTCGGAGGTCGTGAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilI Neisseria gonorrhoeae MS11

90.732

100

0.907

  pilV Neisseria gonorrhoeae MS11

90.732

100

0.907

  pilV Neisseria meningitidis 8013

82.297

100

0.839