Detailed information
Overview
| Name | pilH | Type | Machinery gene |
| Locus tag | KWY96_RS05515 | Genome accession | NZ_CP078116 |
| Coordinates | 1068188..1068850 (-) | Length | 220 a.a. |
| NCBI ID | WP_025455984.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 88G285 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1026726..1075958 | 1068188..1068850 | within | 0 |
Gene organization within MGE regions
Location: 1026726..1075958
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KWY96_RS05235 (KWY96_05235) | - | 1026726..1027577 (+) | 852 | WP_003695018.1 | Bro-N domain-containing protein | - |
| KWY96_RS05240 (KWY96_05240) | - | 1027763..1028437 (-) | 675 | WP_003695013.1 | hypothetical protein | - |
| KWY96_RS05245 (KWY96_05245) | - | 1028434..1028919 (-) | 486 | WP_003687997.1 | hypothetical protein | - |
| KWY96_RS05250 (KWY96_05250) | - | 1028925..1029398 (-) | 474 | WP_003687996.1 | hypothetical protein | - |
| KWY96_RS05255 (KWY96_05255) | - | 1029453..1030748 (-) | 1296 | WP_003695011.1 | DUF4043 family protein | - |
| KWY96_RS05260 (KWY96_05260) | - | 1031374..1038635 (-) | 7262 | Protein_1029 | PLxRFG domain-containing protein | - |
| KWY96_RS11580 | - | 1038632..1038856 (-) | 225 | WP_256347173.1 | hypothetical protein | - |
| KWY96_RS05270 (KWY96_05270) | - | 1038914..1039828 (-) | 915 | WP_256347174.1 | hypothetical protein | - |
| KWY96_RS05275 (KWY96_05275) | - | 1040065..1042332 (-) | 2268 | WP_229692682.1 | hypothetical protein | - |
| KWY96_RS05280 (KWY96_05280) | - | 1042317..1043591 (-) | 1275 | WP_003695006.1 | PBSX family phage terminase large subunit | - |
| KWY96_RS11585 | - | 1043572..1044111 (-) | 540 | WP_003690920.1 | hypothetical protein | - |
| KWY96_RS05295 (KWY96_05295) | - | 1044111..1044533 (-) | 423 | WP_003690919.1 | hypothetical protein | - |
| KWY96_RS05300 (KWY96_05300) | - | 1044598..1045116 (-) | 519 | WP_003687984.1 | HNH endonuclease | - |
| KWY96_RS05305 (KWY96_05305) | - | 1045107..1045490 (-) | 384 | WP_003690918.1 | recombination protein NinB | - |
| KWY96_RS05310 (KWY96_05310) | - | 1045487..1045792 (-) | 306 | WP_003687981.1 | nuclease domain-containing protein | - |
| KWY96_RS05315 (KWY96_05315) | - | 1045785..1046222 (-) | 438 | WP_123794336.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KWY96_RS11590 | - | 1046213..1046494 (-) | 282 | WP_003689109.1 | hypothetical protein | - |
| KWY96_RS05320 (KWY96_05320) | - | 1046523..1046672 (-) | 150 | WP_003689110.1 | hypothetical protein | - |
| KWY96_RS05325 (KWY96_05325) | - | 1046849..1047343 (-) | 495 | WP_041421248.1 | DUF3310 domain-containing protein | - |
| KWY96_RS05330 (KWY96_05330) | - | 1047382..1047645 (-) | 264 | WP_218422957.1 | hypothetical protein | - |
| KWY96_RS05335 (KWY96_05335) | - | 1047682..1049043 (-) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| KWY96_RS11845 (KWY96_05340) | - | 1049040..1050104 (-) | 1065 | WP_003693470.1 | hypothetical protein | - |
| KWY96_RS05345 (KWY96_05345) | - | 1050222..1050449 (-) | 228 | WP_050158909.1 | helix-turn-helix domain-containing protein | - |
| KWY96_RS05350 (KWY96_05350) | - | 1050622..1050810 (+) | 189 | WP_050157615.1 | hypothetical protein | - |
| KWY96_RS05355 (KWY96_05355) | - | 1050787..1050942 (-) | 156 | WP_003698902.1 | hypothetical protein | - |
| KWY96_RS05360 (KWY96_05360) | - | 1051022..1051258 (-) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| KWY96_RS05365 (KWY96_05365) | - | 1051381..1052043 (+) | 663 | WP_012503489.1 | LexA family transcriptional regulator | - |
| KWY96_RS05370 (KWY96_05370) | - | 1052156..1052593 (+) | 438 | WP_003687967.1 | hypothetical protein | - |
| KWY96_RS05375 (KWY96_05375) | - | 1052610..1053071 (+) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| KWY96_RS05380 (KWY96_05380) | - | 1053068..1053481 (+) | 414 | WP_003687963.1 | hypothetical protein | - |
| KWY96_RS05385 (KWY96_05385) | - | 1053679..1053879 (+) | 201 | WP_047920246.1 | hypothetical protein | - |
| KWY96_RS05390 (KWY96_05390) | - | 1053912..1054388 (+) | 477 | WP_002255718.1 | hypothetical protein | - |
| KWY96_RS05395 (KWY96_05395) | - | 1054385..1054672 (+) | 288 | WP_218422916.1 | hypothetical protein | - |
| KWY96_RS05400 (KWY96_05400) | - | 1054813..1055145 (+) | 333 | WP_033910331.1 | phage associated protein | - |
| KWY96_RS05405 (KWY96_05405) | - | 1055298..1055573 (+) | 276 | WP_048654501.1 | NGO1622 family putative holin | - |
| KWY96_RS05410 (KWY96_05410) | - | 1055570..1055731 (+) | 162 | WP_003691530.1 | hypothetical protein | - |
| KWY96_RS05415 (KWY96_05415) | - | 1055800..1056486 (+) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| KWY96_RS05420 (KWY96_05420) | - | 1056626..1056808 (+) | 183 | WP_004464808.1 | hypothetical protein | - |
| KWY96_RS05425 (KWY96_05425) | - | 1056805..1057296 (+) | 492 | WP_047916888.1 | siphovirus Gp157 family protein | - |
| KWY96_RS05430 (KWY96_05430) | - | 1057348..1057563 (+) | 216 | WP_003691538.1 | hypothetical protein | - |
| KWY96_RS11850 | - | 1057674..1057907 (+) | 234 | Protein_1064 | hypothetical protein | - |
| KWY96_RS05440 (KWY96_05440) | - | 1058221..1058904 (+) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| KWY96_RS05445 (KWY96_05445) | - | 1059099..1059368 (+) | 270 | WP_003687928.1 | hypothetical protein | - |
| KWY96_RS05455 (KWY96_05455) | - | 1059724..1060924 (-) | 1201 | Protein_1067 | tyrosine-type recombinase/integrase | - |
| KWY96_RS05470 (KWY96_05470) | yaaA | 1061454..1062233 (-) | 780 | WP_003687925.1 | peroxide stress protein YaaA | - |
| KWY96_RS05475 (KWY96_05475) | dapC | 1062544..1063731 (-) | 1188 | WP_003687924.1 | succinyldiaminopimelate transaminase | - |
| KWY96_RS05480 (KWY96_05480) | dut | 1063809..1064261 (-) | 453 | WP_003687923.1 | dUTP diphosphatase | - |
| KWY96_RS05485 (KWY96_05485) | - | 1064427..1065134 (+) | 708 | Protein_1071 | AzlC family ABC transporter permease | - |
| KWY96_RS05490 (KWY96_05490) | - | 1065131..1065439 (+) | 309 | WP_010951048.1 | AzlD family protein | - |
| KWY96_RS05495 (KWY96_05495) | pilL | 1065509..1065982 (-) | 474 | WP_218422965.1 | PilX family type IV pilin | Machinery gene |
| KWY96_RS05500 (KWY96_05500) | pilK | 1065984..1066595 (-) | 612 | WP_218422958.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| KWY96_RS05505 (KWY96_05505) | pilJ | 1066574..1067542 (-) | 969 | WP_010359920.1 | PilW family protein | Machinery gene |
| KWY96_RS05510 (KWY96_05510) | pilI | 1067539..1068156 (-) | 618 | WP_010359918.1 | type IV pilus modification protein PilV | Machinery gene |
| KWY96_RS05515 (KWY96_05515) | pilH | 1068188..1068850 (-) | 663 | WP_025455984.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| KWY96_RS05520 (KWY96_05520) | dnaB | 1069158..1070564 (-) | 1407 | WP_003701055.1 | replicative DNA helicase | - |
| KWY96_RS05525 (KWY96_05525) | - | 1070728..1071309 (+) | 582 | WP_003698180.1 | superoxide dismutase | - |
| KWY96_RS05530 (KWY96_05530) | - | 1071539..1072048 (-) | 510 | WP_218422959.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| KWY96_RS05535 (KWY96_05535) | - | 1072375..1072707 (-) | 333 | WP_003687908.1 | hypothetical protein | - |
| KWY96_RS05540 (KWY96_05540) | cysT | 1072893..1073731 (+) | 839 | Protein_1082 | sulfate ABC transporter permease subunit CysT | - |
| KWY96_RS05545 (KWY96_05545) | cysW | 1073920..1074741 (+) | 822 | WP_082298537.1 | sulfate ABC transporter permease subunit CysW | - |
| KWY96_RS05550 (KWY96_05550) | - | 1074737..1074844 (+) | 108 | Protein_1084 | IS5/IS1182 family transposase | - |
| KWY96_RS05555 (KWY96_05555) | - | 1074882..1075958 (+) | 1077 | WP_003701047.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 220 a.a. Molecular weight: 24465.93 Da Isoelectric Point: 9.4068
>NTDB_id=586977 KWY96_RS05515 WP_025455984.1 1068188..1068850(-) (pilH) [Neisseria gonorrhoeae strain 88G285]
MCTRKQQGFTLTELLIVMAIAAIMATIALPNMSGWIASRRIASHAEQVANLLRFSRGEAVRLNLPVYICPVQVKKDGASN
NRCDFSKKGRGMLAFGDKNGNKAYDGDEADVFLRSVVLNDTDDSRINYAFNHIAFGQIQPTAERVVWTFNQNGTFGYLSD
QNLKDNSKFVYSDGYIQIVLTDAKAVSVDEKKFRSAVVLINSSGRVEVCRKNDTRAVCKH
MCTRKQQGFTLTELLIVMAIAAIMATIALPNMSGWIASRRIASHAEQVANLLRFSRGEAVRLNLPVYICPVQVKKDGASN
NRCDFSKKGRGMLAFGDKNGNKAYDGDEADVFLRSVVLNDTDDSRINYAFNHIAFGQIQPTAERVVWTFNQNGTFGYLSD
QNLKDNSKFVYSDGYIQIVLTDAKAVSVDEKKFRSAVVLINSSGRVEVCRKNDTRAVCKH
Nucleotide
Download Length: 663 bp
>NTDB_id=586977 KWY96_RS05515 WP_025455984.1 1068188..1068850(-) (pilH) [Neisseria gonorrhoeae strain 88G285]
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGCCATTGCAGCCATTATGGCGACGAT
AGCCCTCCCCAATATGAGTGGGTGGATTGCATCACGCCGCATTGCCAGTCACGCGGAGCAGGTTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTGTTCAAGTTAAAAAAGACGGTGCGTCCAAC
AATAGATGTGACTTCAGCAAGAAGGGGCGGGGAATGTTGGCTTTCGGCGACAAAAACGGCAATAAGGCATATGACGGTGA
TGAGGCGGATGTTTTCCTCCGCAGCGTGGTGTTGAATGATACCGACGACAGCCGGATTAATTATGCCTTCAACCATATCG
CTTTCGGTCAAATACAGCCGACTGCCGAACGTGTTGTTTGGACTTTCAACCAAAACGGGACATTCGGCTATTTGTCCGAT
CAGAATCTCAAGGATAATTCCAAATTTGTTTATTCTGACGGTTATATCCAAATCGTGTTGACAGATGCGAAGGCGGTTTC
TGTCGATGAAAAAAAATTCCGTTCGGCGGTGGTTTTGATTAACAGCAGCGGCAGGGTTGAAGTTTGTCGTAAAAACGATA
CGCGCGCCGTATGCAAACATTAA
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGCCATTGCAGCCATTATGGCGACGAT
AGCCCTCCCCAATATGAGTGGGTGGATTGCATCACGCCGCATTGCCAGTCACGCGGAGCAGGTTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTGTTCAAGTTAAAAAAGACGGTGCGTCCAAC
AATAGATGTGACTTCAGCAAGAAGGGGCGGGGAATGTTGGCTTTCGGCGACAAAAACGGCAATAAGGCATATGACGGTGA
TGAGGCGGATGTTTTCCTCCGCAGCGTGGTGTTGAATGATACCGACGACAGCCGGATTAATTATGCCTTCAACCATATCG
CTTTCGGTCAAATACAGCCGACTGCCGAACGTGTTGTTTGGACTTTCAACCAAAACGGGACATTCGGCTATTTGTCCGAT
CAGAATCTCAAGGATAATTCCAAATTTGTTTATTCTGACGGTTATATCCAAATCGTGTTGACAGATGCGAAGGCGGTTTC
TGTCGATGAAAAAAAATTCCGTTCGGCGGTGGTTTTGATTAACAGCAGCGGCAGGGTTGAAGTTTGTCGTAAAAACGATA
CGCGCGCCGTATGCAAACATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilH | Neisseria gonorrhoeae MS11 |
94.545 |
100 |
0.945 |