Detailed information
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | KWY97_RS05980 | Genome accession | NZ_CP078114 |
| Coordinates | 1147163..1147636 (-) | Length | 157 a.a. |
| NCBI ID | WP_012503482.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 98D159 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1108421..1160389 | 1147163..1147636 | within | 0 |
Gene organization within MGE regions
Location: 1108421..1160389
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KWY97_RS05715 (KWY97_05715) | - | 1108421..1109266 (+) | 846 | WP_003690940.1 | BRO family protein | - |
| KWY97_RS05720 (KWY97_05720) | - | 1109303..1109452 (-) | 150 | WP_003706419.1 | hypothetical protein | - |
| KWY97_RS05725 (KWY97_05725) | - | 1109455..1110129 (-) | 675 | WP_003687998.1 | hypothetical protein | - |
| KWY97_RS05730 (KWY97_05730) | - | 1110126..1110611 (-) | 486 | WP_003687997.1 | hypothetical protein | - |
| KWY97_RS05735 (KWY97_05735) | - | 1110617..1111090 (-) | 474 | WP_003690936.1 | hypothetical protein | - |
| KWY97_RS05740 (KWY97_05740) | - | 1111145..1112440 (-) | 1296 | WP_003690933.1 | DUF4043 family protein | - |
| KWY97_RS11770 | - | 1112461..1113198 (-) | 738 | WP_003690932.1 | hypothetical protein | - |
| KWY97_RS12075 (KWY97_05745) | - | 1113180..1118975 (-) | 5796 | Protein_1133 | PLxRFG domain-containing protein | - |
| KWY97_RS05750 (KWY97_05750) | - | 1119178..1120392 (-) | 1215 | WP_047954539.1 | hypothetical protein | - |
| KWY97_RS05755 (KWY97_05755) | - | 1120389..1121585 (-) | 1197 | WP_215322114.1 | hypothetical protein | - |
| KWY97_RS05760 (KWY97_05760) | - | 1121822..1124089 (-) | 2268 | WP_225577699.1 | hypothetical protein | - |
| KWY97_RS05765 (KWY97_05765) | - | 1124074..1125348 (-) | 1275 | WP_003701186.1 | PBSX family phage terminase large subunit | - |
| KWY97_RS11780 | - | 1125329..1125868 (-) | 540 | WP_003690920.1 | hypothetical protein | - |
| KWY97_RS05780 (KWY97_05780) | - | 1125868..1126290 (-) | 423 | WP_003690919.1 | hypothetical protein | - |
| KWY97_RS05785 (KWY97_05785) | - | 1126355..1126873 (-) | 519 | WP_003687984.1 | HNH endonuclease | - |
| KWY97_RS05790 (KWY97_05790) | - | 1126864..1127247 (-) | 384 | WP_003690918.1 | recombination protein NinB | - |
| KWY97_RS05795 (KWY97_05795) | - | 1127244..1127549 (-) | 306 | WP_003687981.1 | nuclease domain-containing protein | - |
| KWY97_RS05800 (KWY97_05800) | - | 1127542..1127979 (-) | 438 | WP_047918627.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KWY97_RS11785 | - | 1127970..1128251 (-) | 282 | WP_003689109.1 | hypothetical protein | - |
| KWY97_RS05805 (KWY97_05805) | - | 1128280..1128429 (-) | 150 | WP_003689110.1 | hypothetical protein | - |
| KWY97_RS05810 (KWY97_05810) | - | 1128606..1129100 (-) | 495 | WP_115067539.1 | DUF3310 domain-containing protein | - |
| KWY97_RS05815 (KWY97_05815) | - | 1129175..1129420 (-) | 246 | WP_218446803.1 | hypothetical protein | - |
| KWY97_RS05820 (KWY97_05820) | - | 1129437..1130798 (-) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| KWY97_RS12080 (KWY97_05825) | - | 1130795..1131925 (-) | 1131 | WP_048589519.1 | hypothetical protein | - |
| KWY97_RS05830 (KWY97_05830) | - | 1132043..1132270 (-) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| KWY97_RS05835 (KWY97_05835) | - | 1132443..1132631 (+) | 189 | WP_003698903.1 | hypothetical protein | - |
| KWY97_RS05840 (KWY97_05840) | - | 1132608..1132763 (-) | 156 | WP_003703527.1 | hypothetical protein | - |
| KWY97_RS05845 (KWY97_05845) | - | 1132843..1133079 (-) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| KWY97_RS05850 (KWY97_05850) | - | 1133202..1133864 (+) | 663 | WP_012503489.1 | LexA family transcriptional regulator | - |
| KWY97_RS05855 (KWY97_05855) | - | 1133979..1134416 (+) | 438 | WP_003687967.1 | hypothetical protein | - |
| KWY97_RS05860 (KWY97_05860) | - | 1134433..1134894 (+) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| KWY97_RS05865 (KWY97_05865) | - | 1134891..1135304 (+) | 414 | WP_003687963.1 | hypothetical protein | - |
| KWY97_RS05870 (KWY97_05870) | - | 1135502..1135702 (+) | 201 | WP_047954343.1 | hypothetical protein | - |
| KWY97_RS05875 (KWY97_05875) | - | 1135735..1136211 (+) | 477 | WP_002255718.1 | hypothetical protein | - |
| KWY97_RS05880 (KWY97_05880) | - | 1136208..1136483 (+) | 276 | WP_047925817.1 | hypothetical protein | - |
| KWY97_RS05885 (KWY97_05885) | - | 1136624..1136956 (+) | 333 | WP_003687946.1 | hypothetical protein | - |
| KWY97_RS05890 (KWY97_05890) | - | 1137109..1137384 (+) | 276 | WP_003694990.1 | NGO1622 family putative holin | - |
| KWY97_RS05895 (KWY97_05895) | - | 1137381..1137542 (+) | 162 | WP_003693867.1 | hypothetical protein | - |
| KWY97_RS05900 (KWY97_05900) | - | 1137611..1138297 (+) | 687 | WP_033910330.1 | phage replication initiation protein, NGO0469 family | - |
| KWY97_RS05905 (KWY97_05905) | - | 1138437..1138619 (+) | 183 | WP_218446804.1 | hypothetical protein | - |
| KWY97_RS05910 (KWY97_05910) | - | 1138616..1139107 (+) | 492 | WP_218446805.1 | siphovirus Gp157 family protein | - |
| KWY97_RS05915 (KWY97_05915) | - | 1139159..1139374 (+) | 216 | WP_003691538.1 | hypothetical protein | - |
| KWY97_RS12085 | - | 1139485..1139718 (+) | 234 | Protein_1168 | hypothetical protein | - |
| KWY97_RS05925 (KWY97_05925) | - | 1140032..1140715 (+) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| KWY97_RS05930 (KWY97_05930) | - | 1140910..1141179 (+) | 270 | WP_003687928.1 | hypothetical protein | - |
| KWY97_RS05940 (KWY97_05940) | - | 1141535..1142735 (-) | 1201 | Protein_1171 | tyrosine-type recombinase/integrase | - |
| KWY97_RS05955 (KWY97_05955) | yaaA | 1143265..1144044 (-) | 780 | WP_003687925.1 | peroxide stress protein YaaA | - |
| KWY97_RS05960 (KWY97_05960) | dapC | 1144200..1145387 (-) | 1188 | WP_003701073.1 | succinyldiaminopimelate transaminase | - |
| KWY97_RS05965 (KWY97_05965) | dut | 1145459..1145911 (-) | 453 | WP_003701071.1 | dUTP diphosphatase | - |
| KWY97_RS05970 (KWY97_05970) | - | 1146077..1146788 (+) | 712 | Protein_1175 | AzlC family ABC transporter permease | - |
| KWY97_RS05975 (KWY97_05975) | - | 1146785..1147093 (+) | 309 | WP_025456241.1 | AzlD family protein | - |
| KWY97_RS05980 (KWY97_05980) | pilL | 1147163..1147636 (-) | 474 | WP_012503482.1 | PilX family type IV pilin | Machinery gene |
| KWY97_RS05985 (KWY97_05985) | pilK | 1147638..1148249 (-) | 612 | WP_218446806.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| KWY97_RS05990 (KWY97_05990) | pilJ | 1148228..1149196 (-) | 969 | WP_003702438.1 | PilW family protein | Machinery gene |
| KWY97_RS05995 (KWY97_05995) | pilI | 1149193..1149801 (-) | 609 | WP_218446807.1 | type IV pilus modification protein PilV | Machinery gene |
| KWY97_RS06000 (KWY97_06000) | pilH | 1149833..1150498 (-) | 666 | WP_218446905.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| KWY97_RS06005 (KWY97_06005) | dnaB | 1150806..1152212 (-) | 1407 | WP_218446808.1 | replicative DNA helicase | - |
| KWY97_RS06010 (KWY97_06010) | - | 1152376..1152957 (+) | 582 | WP_003698180.1 | superoxide dismutase | - |
| KWY97_RS06015 (KWY97_06015) | - | 1153189..1153698 (-) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| KWY97_RS06020 (KWY97_06020) | - | 1154025..1154357 (-) | 333 | WP_003687908.1 | hypothetical protein | - |
| KWY97_RS06025 (KWY97_06025) | cysT | 1154538..1155367 (+) | 830 | Protein_1186 | sulfate ABC transporter permease subunit CysT | - |
| KWY97_RS06030 (KWY97_06030) | cysW | 1155556..1156416 (+) | 861 | WP_082298768.1 | sulfate ABC transporter permease subunit CysW | - |
| KWY97_RS06035 (KWY97_06035) | - | 1156413..1157489 (+) | 1077 | WP_003687905.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| KWY97_RS06040 (KWY97_06040) | ilvA | 1157545..1159071 (-) | 1527 | WP_003690890.1 | threonine ammonia-lyase, biosynthetic | - |
| KWY97_RS06045 (KWY97_06045) | - | 1159220..1160389 (+) | 1170 | WP_003687902.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17486.30 Da Isoelectric Point: 9.9561
>NTDB_id=586883 KWY97_RS05980 WP_012503482.1 1147163..1147636(-) (pilL) [Neisseria gonorrhoeae strain 98D159]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=586883 KWY97_RS05980 WP_012503482.1 1147163..1147636(-) (pilL) [Neisseria gonorrhoeae strain 98D159]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
91.72 |
100 |
0.917 |
| pilX | Neisseria meningitidis 8013 |
85.35 |
100 |
0.854 |