Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilK   Type   Machinery gene
Locus tag   KWY97_RS05985 Genome accession   NZ_CP078114
Coordinates   1147638..1148249 (-) Length   203 a.a.
NCBI ID   WP_218446806.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 98D159     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1108421..1160389 1147638..1148249 within 0


Gene organization within MGE regions


Location: 1108421..1160389
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KWY97_RS05715 (KWY97_05715) - 1108421..1109266 (+) 846 WP_003690940.1 BRO family protein -
  KWY97_RS05720 (KWY97_05720) - 1109303..1109452 (-) 150 WP_003706419.1 hypothetical protein -
  KWY97_RS05725 (KWY97_05725) - 1109455..1110129 (-) 675 WP_003687998.1 hypothetical protein -
  KWY97_RS05730 (KWY97_05730) - 1110126..1110611 (-) 486 WP_003687997.1 hypothetical protein -
  KWY97_RS05735 (KWY97_05735) - 1110617..1111090 (-) 474 WP_003690936.1 hypothetical protein -
  KWY97_RS05740 (KWY97_05740) - 1111145..1112440 (-) 1296 WP_003690933.1 DUF4043 family protein -
  KWY97_RS11770 - 1112461..1113198 (-) 738 WP_003690932.1 hypothetical protein -
  KWY97_RS12075 (KWY97_05745) - 1113180..1118975 (-) 5796 Protein_1133 PLxRFG domain-containing protein -
  KWY97_RS05750 (KWY97_05750) - 1119178..1120392 (-) 1215 WP_047954539.1 hypothetical protein -
  KWY97_RS05755 (KWY97_05755) - 1120389..1121585 (-) 1197 WP_215322114.1 hypothetical protein -
  KWY97_RS05760 (KWY97_05760) - 1121822..1124089 (-) 2268 WP_225577699.1 hypothetical protein -
  KWY97_RS05765 (KWY97_05765) - 1124074..1125348 (-) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  KWY97_RS11780 - 1125329..1125868 (-) 540 WP_003690920.1 hypothetical protein -
  KWY97_RS05780 (KWY97_05780) - 1125868..1126290 (-) 423 WP_003690919.1 hypothetical protein -
  KWY97_RS05785 (KWY97_05785) - 1126355..1126873 (-) 519 WP_003687984.1 HNH endonuclease -
  KWY97_RS05790 (KWY97_05790) - 1126864..1127247 (-) 384 WP_003690918.1 recombination protein NinB -
  KWY97_RS05795 (KWY97_05795) - 1127244..1127549 (-) 306 WP_003687981.1 nuclease domain-containing protein -
  KWY97_RS05800 (KWY97_05800) - 1127542..1127979 (-) 438 WP_047918627.1 RusA family crossover junction endodeoxyribonuclease -
  KWY97_RS11785 - 1127970..1128251 (-) 282 WP_003689109.1 hypothetical protein -
  KWY97_RS05805 (KWY97_05805) - 1128280..1128429 (-) 150 WP_003689110.1 hypothetical protein -
  KWY97_RS05810 (KWY97_05810) - 1128606..1129100 (-) 495 WP_115067539.1 DUF3310 domain-containing protein -
  KWY97_RS05815 (KWY97_05815) - 1129175..1129420 (-) 246 WP_218446803.1 hypothetical protein -
  KWY97_RS05820 (KWY97_05820) - 1129437..1130798 (-) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  KWY97_RS12080 (KWY97_05825) - 1130795..1131925 (-) 1131 WP_048589519.1 hypothetical protein -
  KWY97_RS05830 (KWY97_05830) - 1132043..1132270 (-) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  KWY97_RS05835 (KWY97_05835) - 1132443..1132631 (+) 189 WP_003698903.1 hypothetical protein -
  KWY97_RS05840 (KWY97_05840) - 1132608..1132763 (-) 156 WP_003703527.1 hypothetical protein -
  KWY97_RS05845 (KWY97_05845) - 1132843..1133079 (-) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  KWY97_RS05850 (KWY97_05850) - 1133202..1133864 (+) 663 WP_012503489.1 LexA family transcriptional regulator -
  KWY97_RS05855 (KWY97_05855) - 1133979..1134416 (+) 438 WP_003687967.1 hypothetical protein -
  KWY97_RS05860 (KWY97_05860) - 1134433..1134894 (+) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  KWY97_RS05865 (KWY97_05865) - 1134891..1135304 (+) 414 WP_003687963.1 hypothetical protein -
  KWY97_RS05870 (KWY97_05870) - 1135502..1135702 (+) 201 WP_047954343.1 hypothetical protein -
  KWY97_RS05875 (KWY97_05875) - 1135735..1136211 (+) 477 WP_002255718.1 hypothetical protein -
  KWY97_RS05880 (KWY97_05880) - 1136208..1136483 (+) 276 WP_047925817.1 hypothetical protein -
  KWY97_RS05885 (KWY97_05885) - 1136624..1136956 (+) 333 WP_003687946.1 hypothetical protein -
  KWY97_RS05890 (KWY97_05890) - 1137109..1137384 (+) 276 WP_003694990.1 NGO1622 family putative holin -
  KWY97_RS05895 (KWY97_05895) - 1137381..1137542 (+) 162 WP_003693867.1 hypothetical protein -
  KWY97_RS05900 (KWY97_05900) - 1137611..1138297 (+) 687 WP_033910330.1 phage replication initiation protein, NGO0469 family -
  KWY97_RS05905 (KWY97_05905) - 1138437..1138619 (+) 183 WP_218446804.1 hypothetical protein -
  KWY97_RS05910 (KWY97_05910) - 1138616..1139107 (+) 492 WP_218446805.1 siphovirus Gp157 family protein -
  KWY97_RS05915 (KWY97_05915) - 1139159..1139374 (+) 216 WP_003691538.1 hypothetical protein -
  KWY97_RS12085 - 1139485..1139718 (+) 234 Protein_1168 hypothetical protein -
  KWY97_RS05925 (KWY97_05925) - 1140032..1140715 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  KWY97_RS05930 (KWY97_05930) - 1140910..1141179 (+) 270 WP_003687928.1 hypothetical protein -
  KWY97_RS05940 (KWY97_05940) - 1141535..1142735 (-) 1201 Protein_1171 tyrosine-type recombinase/integrase -
  KWY97_RS05955 (KWY97_05955) yaaA 1143265..1144044 (-) 780 WP_003687925.1 peroxide stress protein YaaA -
  KWY97_RS05960 (KWY97_05960) dapC 1144200..1145387 (-) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  KWY97_RS05965 (KWY97_05965) dut 1145459..1145911 (-) 453 WP_003701071.1 dUTP diphosphatase -
  KWY97_RS05970 (KWY97_05970) - 1146077..1146788 (+) 712 Protein_1175 AzlC family ABC transporter permease -
  KWY97_RS05975 (KWY97_05975) - 1146785..1147093 (+) 309 WP_025456241.1 AzlD family protein -
  KWY97_RS05980 (KWY97_05980) pilL 1147163..1147636 (-) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  KWY97_RS05985 (KWY97_05985) pilK 1147638..1148249 (-) 612 WP_218446806.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  KWY97_RS05990 (KWY97_05990) pilJ 1148228..1149196 (-) 969 WP_003702438.1 PilW family protein Machinery gene
  KWY97_RS05995 (KWY97_05995) pilI 1149193..1149801 (-) 609 WP_218446807.1 type IV pilus modification protein PilV Machinery gene
  KWY97_RS06000 (KWY97_06000) pilH 1149833..1150498 (-) 666 WP_218446905.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  KWY97_RS06005 (KWY97_06005) dnaB 1150806..1152212 (-) 1407 WP_218446808.1 replicative DNA helicase -
  KWY97_RS06010 (KWY97_06010) - 1152376..1152957 (+) 582 WP_003698180.1 superoxide dismutase -
  KWY97_RS06015 (KWY97_06015) - 1153189..1153698 (-) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  KWY97_RS06020 (KWY97_06020) - 1154025..1154357 (-) 333 WP_003687908.1 hypothetical protein -
  KWY97_RS06025 (KWY97_06025) cysT 1154538..1155367 (+) 830 Protein_1186 sulfate ABC transporter permease subunit CysT -
  KWY97_RS06030 (KWY97_06030) cysW 1155556..1156416 (+) 861 WP_082298768.1 sulfate ABC transporter permease subunit CysW -
  KWY97_RS06035 (KWY97_06035) - 1156413..1157489 (+) 1077 WP_003687905.1 sulfate/molybdate ABC transporter ATP-binding protein -
  KWY97_RS06040 (KWY97_06040) ilvA 1157545..1159071 (-) 1527 WP_003690890.1 threonine ammonia-lyase, biosynthetic -
  KWY97_RS06045 (KWY97_06045) - 1159220..1160389 (+) 1170 WP_003687902.1 D-alanyl-D-alanine carboxypeptidase family protein -

Sequence

Protein


Download         Length: 203 a.a.        Molecular weight: 22135.16 Da        Isoelectric Point: 8.7658

>NTDB_id=586884 KWY97_RS05985 WP_218446806.1 1147638..1148249(-) (pilK) [Neisseria gonorrhoeae strain 98D159]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEAFGNIVVKGKPIVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTASVSKMP
RYIIEYLGEKNNQKIYRVTAKAWGKNANTVVVLQSYVGNNDEQ

Nucleotide


Download         Length: 612 bp        

>NTDB_id=586884 KWY97_RS05985 WP_218446806.1 1147638..1148249(-) (pilK) [Neisseria gonorrhoeae strain 98D159]
ATGCGCAAACAGAACACTTTGACGGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAGCAGCGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGCCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGAAAGGCAAGCCCATCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGGACGGCAAGCGTCAGCAAAATGCCG
CGTTATATTATCGAATATTTGGGCGAGAAGAATAACCAAAAGATTTACAGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA

Domains

Predicted by InterproScan.

PilX N-terminal (PilX_N)

(17-67)

Type IV pilus assembly protein PilX C-term (PilX)

(92-198)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

95.567

100

0.956