Detailed information
Overview
| Name | comP | Type | Machinery gene |
| Locus tag | KWY97_RS00465 | Genome accession | NZ_CP078114 |
| Coordinates | 87624..88073 (+) | Length | 149 a.a. |
| NCBI ID | WP_002214937.1 | Uniprot ID | A0AA44U8B7 |
| Organism | Neisseria gonorrhoeae strain 98D159 | ||
| Function | DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 88322..121513 | 87624..88073 | flank | 249 |
Gene organization within MGE regions
Location: 87624..121513
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KWY97_RS00465 (KWY97_00465) | comP | 87624..88073 (+) | 450 | WP_002214937.1 | type IV pilin protein | Machinery gene |
| KWY97_RS00470 (KWY97_00470) | - | 88450..88596 (-) | 147 | WP_003691757.1 | hypothetical protein | - |
| KWY97_RS00475 (KWY97_00475) | - | 89013..89561 (+) | 549 | WP_263863916.1 | DNA cytosine methyltransferase | - |
| KWY97_RS00480 (KWY97_00480) | - | 89600..89929 (+) | 330 | WP_002234365.1 | DNA cytosine methyltransferase | - |
| KWY97_RS11380 | - | 89943..90800 (+) | 858 | WP_012503917.1 | ATP-binding protein | - |
| KWY97_RS11385 | - | 90990..91586 (+) | 597 | WP_012503916.1 | TIGR02391 family protein | - |
| KWY97_RS00490 (KWY97_00490) | - | 91592..92014 (+) | 423 | WP_003691751.1 | very short patch repair endonuclease | - |
| KWY97_RS00495 (KWY97_00495) | - | 92153..93502 (+) | 1350 | WP_218446856.1 | replication initiation factor domain-containing protein | - |
| KWY97_RS00500 (KWY97_00500) | - | 93547..93837 (+) | 291 | WP_012503914.1 | hypothetical protein | - |
| KWY97_RS00505 (KWY97_00505) | - | 93842..94039 (+) | 198 | WP_003689600.1 | hypothetical protein | - |
| KWY97_RS00510 (KWY97_00510) | - | 94113..94331 (+) | 219 | WP_003691584.1 | major capsid protein | - |
| KWY97_RS00515 (KWY97_00515) | - | 94338..94616 (+) | 279 | WP_003691583.1 | hypothetical protein | - |
| KWY97_RS00520 (KWY97_00520) | - | 94744..95061 (+) | 318 | WP_003689167.1 | DUF1132 family protein | - |
| KWY97_RS00525 (KWY97_00525) | - | 95003..96571 (+) | 1569 | WP_218446857.1 | IgG-binding virulence factor TspB family protein | - |
| KWY97_RS00530 (KWY97_00530) | - | 96572..96862 (+) | 291 | WP_003689734.1 | DUF2523 domain-containing protein | - |
| KWY97_RS00535 (KWY97_00535) | - | 96872..97957 (+) | 1086 | WP_047922971.1 | zonular occludens toxin domain-containing protein | - |
| KWY97_RS00540 (KWY97_00540) | - | 98078..98437 (+) | 360 | WP_003691563.1 | hypothetical protein | - |
| KWY97_RS00545 (KWY97_00545) | - | 98950..99912 (+) | 963 | WP_048596793.1 | IS110 family transposase | - |
| KWY97_RS00550 (KWY97_00550) | - | 100241..100621 (-) | 381 | WP_033910829.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KWY97_RS11390 | - | 100612..100893 (-) | 282 | WP_003689109.1 | hypothetical protein | - |
| KWY97_RS00555 (KWY97_00555) | - | 100922..101071 (-) | 150 | WP_003689110.1 | hypothetical protein | - |
| KWY97_RS00560 (KWY97_00560) | - | 101248..101742 (-) | 495 | WP_115067539.1 | DUF3310 domain-containing protein | - |
| KWY97_RS00565 (KWY97_00565) | - | 101817..102062 (-) | 246 | WP_218446858.1 | hypothetical protein | - |
| KWY97_RS00570 (KWY97_00570) | - | 102055..102834 (-) | 780 | WP_218446859.1 | ATP-binding protein | - |
| KWY97_RS00575 (KWY97_00575) | - | 102846..103856 (-) | 1011 | WP_218446860.1 | helix-turn-helix domain-containing protein | - |
| KWY97_RS00580 (KWY97_00580) | - | 103853..104080 (-) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| KWY97_RS00585 (KWY97_00585) | - | 104253..104441 (+) | 189 | WP_003698903.1 | hypothetical protein | - |
| KWY97_RS00590 (KWY97_00590) | - | 104418..104573 (-) | 156 | WP_003703527.1 | hypothetical protein | - |
| KWY97_RS00595 (KWY97_00595) | - | 104662..104847 (-) | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| KWY97_RS00600 (KWY97_00600) | - | 104984..105739 (+) | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| KWY97_RS00605 (KWY97_00605) | - | 106012..106830 (+) | 819 | WP_218446861.1 | DUF3037 domain-containing protein | - |
| KWY97_RS00610 (KWY97_00610) | - | 107000..107182 (+) | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | - |
| KWY97_RS00615 (KWY97_00615) | - | 107284..107685 (+) | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| KWY97_RS00620 (KWY97_00620) | - | 107869..108453 (+) | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| KWY97_RS00625 (KWY97_00625) | - | 108462..108878 (+) | 417 | WP_003693479.1 | hypothetical protein | - |
| KWY97_RS00630 (KWY97_00630) | - | 109119..109319 (+) | 201 | WP_218446862.1 | hypothetical protein | - |
| KWY97_RS00635 (KWY97_00635) | - | 109352..109828 (+) | 477 | WP_002255718.1 | hypothetical protein | - |
| KWY97_RS00640 (KWY97_00640) | - | 109825..110100 (+) | 276 | WP_047925817.1 | hypothetical protein | - |
| KWY97_RS00645 (KWY97_00645) | - | 110241..110573 (+) | 333 | WP_003687946.1 | hypothetical protein | - |
| KWY97_RS00650 (KWY97_00650) | - | 110726..111001 (+) | 276 | WP_003694990.1 | NGO1622 family putative holin | - |
| KWY97_RS00655 (KWY97_00655) | - | 110998..111159 (+) | 162 | WP_003693867.1 | hypothetical protein | - |
| KWY97_RS00660 (KWY97_00660) | - | 111228..111914 (+) | 687 | WP_033910330.1 | phage replication initiation protein, NGO0469 family | - |
| KWY97_RS00665 (KWY97_00665) | - | 112054..112236 (+) | 183 | WP_218446804.1 | hypothetical protein | - |
| KWY97_RS00670 (KWY97_00670) | - | 112233..112724 (+) | 492 | WP_218446805.1 | siphovirus Gp157 family protein | - |
| KWY97_RS00675 (KWY97_00675) | - | 112776..112991 (+) | 216 | WP_003691538.1 | hypothetical protein | - |
| KWY97_RS00680 (KWY97_00680) | - | 113102..114085 (+) | 984 | WP_082298685.1 | hypothetical protein | - |
| KWY97_RS00685 (KWY97_00685) | - | 114082..115230 (+) | 1149 | WP_003705649.1 | hypothetical protein | - |
| KWY97_RS00690 (KWY97_00690) | - | 115338..115604 (+) | 267 | WP_003689557.1 | pyocin activator PrtN family protein | - |
| KWY97_RS00695 (KWY97_00695) | - | 115654..116808 (-) | 1155 | WP_003697468.1 | tyrosine-type recombinase/integrase | - |
| KWY97_RS00700 (KWY97_00700) | dusA | 116928..117944 (+) | 1017 | WP_003689555.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| KWY97_RS00705 (KWY97_00705) | gluQRS | 118014..118901 (-) | 888 | WP_003689554.1 | tRNA glutamyl-Q(34) synthetase GluQRS | - |
| KWY97_RS00710 (KWY97_00710) | - | 118918..119208 (-) | 291 | WP_003689553.1 | hypothetical protein | - |
| KWY97_RS11395 | - | 119213..119347 (-) | 135 | WP_256263212.1 | hypothetical protein | - |
| KWY97_RS00715 (KWY97_00715) | tal | 119359..120414 (-) | 1056 | WP_003695503.1 | transaldolase | - |
| KWY97_RS00720 (KWY97_00720) | - | 120511..121485 (+) | 975 | WP_003689550.1 | SIS domain-containing protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16834.81 Da Isoelectric Point: 9.7951
>NTDB_id=586869 KWY97_RS00465 WP_002214937.1 87624..88073(+) (comP) [Neisseria gonorrhoeae strain 98D159]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK
Nucleotide
Download Length: 450 bp
>NTDB_id=586869 KWY97_RS00465 WP_002214937.1 87624..88073(+) (comP) [Neisseria gonorrhoeae strain 98D159]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comP | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comP | Neisseria meningitidis 8013 |
99.329 |
100 |
0.993 |
| comP | Neisseria subflava NJ9703 |
49.66 |
98.658 |
0.49 |