Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KTT68_RS11670 Genome accession   NZ_CP077672
Coordinates   2439959..2440132 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SWUJ1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2434959..2445132
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KTT68_RS11655 gcvT 2435772..2436872 (-) 1101 WP_045208234.1 glycine cleavage system aminomethyltransferase GcvT -
  KTT68_RS11660 - 2437296..2438966 (+) 1671 WP_224223673.1 DEAD/DEAH box helicase -
  KTT68_RS11665 - 2438988..2439782 (+) 795 WP_007408330.1 YqhG family protein -
  KTT68_RS11670 sinI 2439959..2440132 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KTT68_RS11675 sinR 2440166..2440501 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KTT68_RS11680 tasA 2440549..2441334 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KTT68_RS11685 sipW 2441399..2441983 (-) 585 WP_007408328.1 signal peptidase I SipW -
  KTT68_RS11690 tapA 2441955..2442626 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  KTT68_RS11695 - 2442885..2443214 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  KTT68_RS11700 - 2443254..2443433 (-) 180 WP_003153093.1 YqzE family protein -
  KTT68_RS11705 comGG 2443490..2443867 (-) 378 WP_039063315.1 competence type IV pilus minor pilin ComGG -
  KTT68_RS11710 comGF 2443868..2444368 (-) 501 WP_258038902.1 competence type IV pilus minor pilin ComGF -
  KTT68_RS11715 comGE 2444277..2444591 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  KTT68_RS11720 comGD 2444575..2445012 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=582078 KTT68_RS11670 WP_003153105.1 2439959..2440132(+) (sinI) [Bacillus velezensis strain SWUJ1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=582078 KTT68_RS11670 WP_003153105.1 2439959..2440132(+) (sinI) [Bacillus velezensis strain SWUJ1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702