Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KTT68_RS11670 | Genome accession | NZ_CP077672 |
| Coordinates | 2439959..2440132 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SWUJ1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2434959..2445132
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KTT68_RS11655 | gcvT | 2435772..2436872 (-) | 1101 | WP_045208234.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KTT68_RS11660 | - | 2437296..2438966 (+) | 1671 | WP_224223673.1 | DEAD/DEAH box helicase | - |
| KTT68_RS11665 | - | 2438988..2439782 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| KTT68_RS11670 | sinI | 2439959..2440132 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| KTT68_RS11675 | sinR | 2440166..2440501 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| KTT68_RS11680 | tasA | 2440549..2441334 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| KTT68_RS11685 | sipW | 2441399..2441983 (-) | 585 | WP_007408328.1 | signal peptidase I SipW | - |
| KTT68_RS11690 | tapA | 2441955..2442626 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KTT68_RS11695 | - | 2442885..2443214 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| KTT68_RS11700 | - | 2443254..2443433 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| KTT68_RS11705 | comGG | 2443490..2443867 (-) | 378 | WP_039063315.1 | competence type IV pilus minor pilin ComGG | - |
| KTT68_RS11710 | comGF | 2443868..2444368 (-) | 501 | WP_258038902.1 | competence type IV pilus minor pilin ComGF | - |
| KTT68_RS11715 | comGE | 2444277..2444591 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| KTT68_RS11720 | comGD | 2444575..2445012 (-) | 438 | WP_007408322.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=582078 KTT68_RS11670 WP_003153105.1 2439959..2440132(+) (sinI) [Bacillus velezensis strain SWUJ1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=582078 KTT68_RS11670 WP_003153105.1 2439959..2440132(+) (sinI) [Bacillus velezensis strain SWUJ1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |