Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/blpC   Type   Regulator
Locus tag   I6L88_RS00355 Genome accession   NZ_CP077404
Coordinates   69188..69334 (-) Length   48 a.a.
NCBI ID   WP_002280232.1    Uniprot ID   Q1WBZ0
Organism   Streptococcus mutans strain FDAARGOS 1458     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 64188..74334
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6L88_RS00335 (I6L88_00335) - 65185..65811 (+) 627 WP_002265453.1 hypothetical protein -
  I6L88_RS00340 (I6L88_00340) - 65858..66496 (+) 639 WP_002265117.1 VTT domain-containing protein -
  I6L88_RS00345 (I6L88_00345) comE/blpR 66977..67729 (+) 753 WP_002280234.1 response regulator transcription factor Regulator
  I6L88_RS00350 (I6L88_00350) comD/blpH 67726..69051 (+) 1326 WP_002280233.1 sensor histidine kinase Regulator
  I6L88_RS00355 (I6L88_00355) comC/blpC 69188..69334 (-) 147 WP_002280232.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  I6L88_RS00360 (I6L88_00360) - 69601..69822 (+) 222 WP_002312090.1 Blp family class II bacteriocin -
  I6L88_RS00365 (I6L88_00365) - 69853..70071 (+) 219 WP_025985888.1 Blp family class II bacteriocin -
  I6L88_RS00370 (I6L88_00370) - 70157..70561 (+) 405 WP_002280427.1 hypothetical protein -
  I6L88_RS09970 - 70684..70896 (-) 213 Protein_74 IS3 family transposase -
  I6L88_RS00375 (I6L88_00375) - 71336..71500 (+) 165 WP_002265308.1 hypothetical protein -
  I6L88_RS00380 (I6L88_00380) - 71884..72075 (+) 192 WP_002312088.1 Blp family class II bacteriocin -
  I6L88_RS00385 (I6L88_00385) - 72239..72427 (+) 189 WP_002280338.1 Blp family class II bacteriocin -
  I6L88_RS00390 (I6L88_00390) - 72912..73940 (+) 1029 WP_002280337.1 thioredoxin family protein -

Sequence

Protein


Download         Length: 48 a.a.        Molecular weight: 5464.37 Da        Isoelectric Point: 10.7837

>NTDB_id=581284 I6L88_RS00355 WP_002280232.1 69188..69334(-) (comC/blpC) [Streptococcus mutans strain FDAARGOS 1458]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGKIR

Nucleotide


Download         Length: 147 bp        

>NTDB_id=581284 I6L88_RS00355 WP_002280232.1 69188..69334(-) (comC/blpC) [Streptococcus mutans strain FDAARGOS 1458]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAAACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGGAAAATAAGATAG

Domains

Predicted by InterproScan.

COMC family (ComC)

(1-32)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q1WBZ0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

97.826

95.833

0.937