Detailed information NTG0058082

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: SPN994038_RS02610
• Genome accession: NC_021026
• Coordinates: 485617..485766 (+)
• Length: 49 a.a.
• NCBI ID: WP_001808912.1
• Uniprot ID: A0A4J1ZTW6
• Organism: Streptococcus pneumoniae SPN994038
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	475127..484671	485617..485766	flank	946

Gene organization within MGE regions

Location: 475127..485766

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SPN994038_RS02545 (SPN994038_04710)	-	475127..475414 (-)	288	WP_000777760.1	hypothetical protein	-
SPN994038_RS02550 (SPN994038_04720)	-	475424..475834 (-)	411	WP_001278301.1	HIT family protein	-
SPN994038_RS02555 (SPN994038_04730)	pptA	475902..476633 (+)	732	WP_000889923.1	ABC transporter ATP-binding protein	Regulator
SPN994038_RS02560 (SPN994038_04740)	-	476630..477679 (+)	1050	WP_000653752.1	ABC transporter permease	-
SPN994038_RS02565 (SPN994038_04750)	-	477847..478176 (-)	330	WP_000132570.1	hypothetical protein	-
SPN994038_RS02570 (SPN994038_04760)	-	478452..478790 (+)	339	WP_000682119.1	LytTR family DNA-binding domain-containing protein	-
SPN994038_RS02575 (SPN994038_04770)	comE/blpR	478795..479532 (+)	738	WP_001219127.1	response regulator transcription factor	Regulator
SPN994038_RS02580 (SPN994038_04780)	-	479546..480886 (+)	1341	WP_001017622.1	sensor histidine kinase	-
SPN994038_RS02585 (SPN994038_04790)	blpC	480928..481083 (-)	156	WP_000358813.1	quorum-sensing system pheromone BlpC	-
SPN994038_RS02590 (SPN994038_04800)	-	481140..482501 (-)	1362	WP_001069092.1	bacteriocin secretion accessory protein	-
SPN994038_RS13300	comA/nlmT	482512..483000 (-)	489	WP_307774349.1	ATP-binding cassette domain-containing protein	Regulator
SPN994038_RS13305	comA/nlmT	482984..483424 (-)	441	WP_001808911.1	ATP-binding cassette domain-containing protein	Regulator
SPN994038_RS13310	comA/nlmT	483414..484139 (-)	726	WP_167750760.1	ABC transporter transmembrane domain-containing protein	Regulator
SPN994038_RS13315 (SPN994038_04820)	comA/nlmT	484084..484671 (-)	588	WP_000205166.1	cysteine peptidase family C39 domain-containing protein	Regulator
SPN994038_RS02605 (SPN994038_04830)	blpI	484953..485150 (+)	198	WP_001093258.1	bacteriocin-like peptide BlpI	-
SPN994038_RS02610	cipB	485617..485766 (+)	150	WP_001808912.1	bacteriocin-like peptide BlpO	Regulator

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5150.86 Da
• Isoelectric Point: 3.7098

>NTDB_id=58082 SPN994038_RS02610 WP_001808912.1 485617..485766(+) (cipB) [Streptococcus pneumoniae SPN994038]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=58082 SPN994038_RS02610 WP_001808912.1 485617..485766(+) (cipB) [Streptococcus pneumoniae SPN994038]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-41)

3D structure

• AlphaFold DB: A0A4J1ZTW6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	51.02	100	0.51