Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   KSG66_RS11765 Genome accession   NZ_CP077106
Coordinates   2452320..2452697 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain DW-7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2447320..2457697
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KSG66_RS11725 (KSG66_11640) - 2447817..2448611 (+) 795 WP_007612541.1 YqhG family protein -
  KSG66_RS11730 (KSG66_11645) sinI 2448788..2448961 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  KSG66_RS11735 (KSG66_11650) sinR 2448995..2449330 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KSG66_RS11740 (KSG66_11655) tasA 2449378..2450163 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  KSG66_RS11745 (KSG66_11660) sipW 2450228..2450812 (-) 585 WP_032874025.1 signal peptidase I SipW -
  KSG66_RS11750 (KSG66_11665) tapA 2450784..2451455 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  KSG66_RS11755 (KSG66_11670) - 2451714..2452043 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  KSG66_RS11760 (KSG66_11675) - 2452084..2452263 (-) 180 WP_022552966.1 YqzE family protein -
  KSG66_RS11765 (KSG66_11680) comGG 2452320..2452697 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  KSG66_RS11770 (KSG66_11685) comGF 2452698..2453162 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  KSG66_RS11775 (KSG66_11690) comGE 2453107..2453421 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  KSG66_RS11780 (KSG66_11695) comGD 2453405..2453842 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  KSG66_RS11785 (KSG66_11700) comGC 2453832..2454140 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KSG66_RS11790 (KSG66_11705) comGB 2454145..2455182 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  KSG66_RS11795 (KSG66_11710) comGA 2455169..2456239 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  KSG66_RS11800 (KSG66_11715) - 2456436..2457386 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=579347 KSG66_RS11765 WP_032874019.1 2452320..2452697(-) (comGG) [Bacillus velezensis strain DW-7]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=579347 KSG66_RS11765 WP_032874019.1 2452320..2452697(-) (comGG) [Bacillus velezensis strain DW-7]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488