Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KSG66_RS11730 Genome accession   NZ_CP077106
Coordinates   2448788..2448961 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain DW-7     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2443788..2453961
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KSG66_RS11715 (KSG66_11630) gcvT 2444602..2445702 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  KSG66_RS11720 (KSG66_11635) - 2446125..2447795 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  KSG66_RS11725 (KSG66_11640) - 2447817..2448611 (+) 795 WP_007612541.1 YqhG family protein -
  KSG66_RS11730 (KSG66_11645) sinI 2448788..2448961 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  KSG66_RS11735 (KSG66_11650) sinR 2448995..2449330 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KSG66_RS11740 (KSG66_11655) tasA 2449378..2450163 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  KSG66_RS11745 (KSG66_11660) sipW 2450228..2450812 (-) 585 WP_032874025.1 signal peptidase I SipW -
  KSG66_RS11750 (KSG66_11665) tapA 2450784..2451455 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  KSG66_RS11755 (KSG66_11670) - 2451714..2452043 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  KSG66_RS11760 (KSG66_11675) - 2452084..2452263 (-) 180 WP_022552966.1 YqzE family protein -
  KSG66_RS11765 (KSG66_11680) comGG 2452320..2452697 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  KSG66_RS11770 (KSG66_11685) comGF 2452698..2453162 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  KSG66_RS11775 (KSG66_11690) comGE 2453107..2453421 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  KSG66_RS11780 (KSG66_11695) comGD 2453405..2453842 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=579345 KSG66_RS11730 WP_032874029.1 2448788..2448961(+) (sinI) [Bacillus velezensis strain DW-7]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=579345 KSG66_RS11730 WP_032874029.1 2448788..2448961(+) (sinI) [Bacillus velezensis strain DW-7]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719