Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KSG66_RS11730 | Genome accession | NZ_CP077106 |
| Coordinates | 2448788..2448961 (+) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain DW-7 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2443788..2453961
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KSG66_RS11715 (KSG66_11630) | gcvT | 2444602..2445702 (-) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KSG66_RS11720 (KSG66_11635) | - | 2446125..2447795 (+) | 1671 | WP_032874031.1 | DEAD/DEAH box helicase | - |
| KSG66_RS11725 (KSG66_11640) | - | 2447817..2448611 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| KSG66_RS11730 (KSG66_11645) | sinI | 2448788..2448961 (+) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| KSG66_RS11735 (KSG66_11650) | sinR | 2448995..2449330 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| KSG66_RS11740 (KSG66_11655) | tasA | 2449378..2450163 (-) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| KSG66_RS11745 (KSG66_11660) | sipW | 2450228..2450812 (-) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| KSG66_RS11750 (KSG66_11665) | tapA | 2450784..2451455 (-) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KSG66_RS11755 (KSG66_11670) | - | 2451714..2452043 (+) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| KSG66_RS11760 (KSG66_11675) | - | 2452084..2452263 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| KSG66_RS11765 (KSG66_11680) | comGG | 2452320..2452697 (-) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KSG66_RS11770 (KSG66_11685) | comGF | 2452698..2453162 (-) | 465 | WP_223813077.1 | competence type IV pilus minor pilin ComGF | - |
| KSG66_RS11775 (KSG66_11690) | comGE | 2453107..2453421 (-) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| KSG66_RS11780 (KSG66_11695) | comGD | 2453405..2453842 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=579345 KSG66_RS11730 WP_032874029.1 2448788..2448961(+) (sinI) [Bacillus velezensis strain DW-7]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=579345 KSG66_RS11730 WP_032874029.1 2448788..2448961(+) (sinI) [Bacillus velezensis strain DW-7]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |