Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPF93_RS00730 Genome accession   NZ_CP094178
Coordinates   152246..152371 (+) Length   41 a.a.
NCBI ID   WP_001217865.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe060     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 147246..157371
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF93_RS00705 (MPF93_00705) - 147306..149528 (+) 2223 WP_245073940.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF93_RS00710 (MPF93_00710) panD 149518..149868 (+) 351 WP_000142272.1 aspartate 1-decarboxylase -
  MPF93_RS00715 (MPF93_00715) - 149879..150172 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPF93_RS00720 (MPF93_00720) - 150172..151167 (+) 996 WP_245073942.1 PDZ domain-containing protein -
  MPF93_RS00725 (MPF93_00725) comB6 151175..152230 (+) 1056 WP_245073944.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF93_RS00730 (MPF93_00730) comB7 152246..152371 (+) 126 WP_001217865.1 hypothetical protein Machinery gene
  MPF93_RS00735 (MPF93_00735) comB8 152368..153111 (+) 744 WP_245073946.1 virB8 family protein Machinery gene
  MPF93_RS00740 (MPF93_00740) comB9 153111..154073 (+) 963 WP_180506423.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF93_RS00745 (MPF93_00745) comB10 154066..155202 (+) 1137 WP_245073948.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF93_RS00750 (MPF93_00750) - 155268..156671 (+) 1404 WP_245073950.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4794.82 Da        Isoelectric Point: 9.3278

>NTDB_id=577135 MPF93_RS00730 WP_001217865.1 152246..152371(+) (comB7) [Helicobacter pylori strain Hpfe060]
MRIFFVIIGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=577135 MPF93_RS00730 WP_001217865.1 152246..152371(+) (comB7) [Helicobacter pylori strain Hpfe060]
ATGAGAATTTTTTTTGTTATTATTGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829