Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   KOM03_RS16980 Genome accession   NZ_CP076450
Coordinates   3491270..3491584 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain GMEKP1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3486270..3496584
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KOM03_RS16935 (KOM03_16935) sinI 3486953..3487126 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KOM03_RS16940 (KOM03_16940) sinR 3487160..3487495 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KOM03_RS16945 (KOM03_16945) tasA 3487543..3488328 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KOM03_RS16950 (KOM03_16950) sipW 3488392..3488976 (-) 585 WP_060562614.1 signal peptidase I SipW -
  KOM03_RS16955 (KOM03_16955) tapA 3488948..3489619 (-) 672 WP_060562615.1 amyloid fiber anchoring/assembly protein TapA -
  KOM03_RS16960 (KOM03_16960) - 3489878..3490207 (+) 330 WP_060562616.1 DUF3889 domain-containing protein -
  KOM03_RS16965 (KOM03_16965) - 3490247..3490426 (-) 180 WP_003153093.1 YqzE family protein -
  KOM03_RS16970 (KOM03_16970) comGG 3490483..3490860 (-) 378 WP_060562617.1 competence type IV pilus minor pilin ComGG Machinery gene
  KOM03_RS16975 (KOM03_16975) comGF 3490861..3491361 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  KOM03_RS16980 (KOM03_16980) comGE 3491270..3491584 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  KOM03_RS16985 (KOM03_16985) comGD 3491568..3492005 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  KOM03_RS16990 (KOM03_16990) comGC 3491995..3492303 (-) 309 WP_079891096.1 competence type IV pilus major pilin ComGC Machinery gene
  KOM03_RS16995 (KOM03_16995) comGB 3492308..3493345 (-) 1038 WP_060562618.1 competence type IV pilus assembly protein ComGB Machinery gene
  KOM03_RS17000 (KOM03_17000) comGA 3493332..3494402 (-) 1071 WP_007408320.1 competence type IV pilus ATPase ComGA Machinery gene
  KOM03_RS17005 (KOM03_17005) - 3494595..3495545 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=575493 KOM03_RS16980 WP_015388003.1 3491270..3491584(-) (comGE) [Bacillus velezensis strain GMEKP1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=575493 KOM03_RS16980 WP_015388003.1 3491270..3491584(-) (comGE) [Bacillus velezensis strain GMEKP1]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAGC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCTTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481