Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KOM03_RS16935 Genome accession   NZ_CP076450
Coordinates   3486953..3487126 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain GMEKP1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3481953..3492126
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KOM03_RS16920 (KOM03_16920) gcvT 3482770..3483870 (-) 1101 WP_015388009.1 glycine cleavage system aminomethyltransferase GcvT -
  KOM03_RS16925 (KOM03_16925) - 3484294..3485964 (+) 1671 WP_060562612.1 SNF2-related protein -
  KOM03_RS16930 (KOM03_16930) - 3485982..3486776 (+) 795 WP_060562613.1 YqhG family protein -
  KOM03_RS16935 (KOM03_16935) sinI 3486953..3487126 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KOM03_RS16940 (KOM03_16940) sinR 3487160..3487495 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KOM03_RS16945 (KOM03_16945) tasA 3487543..3488328 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KOM03_RS16950 (KOM03_16950) sipW 3488392..3488976 (-) 585 WP_060562614.1 signal peptidase I SipW -
  KOM03_RS16955 (KOM03_16955) tapA 3488948..3489619 (-) 672 WP_060562615.1 amyloid fiber anchoring/assembly protein TapA -
  KOM03_RS16960 (KOM03_16960) - 3489878..3490207 (+) 330 WP_060562616.1 DUF3889 domain-containing protein -
  KOM03_RS16965 (KOM03_16965) - 3490247..3490426 (-) 180 WP_003153093.1 YqzE family protein -
  KOM03_RS16970 (KOM03_16970) comGG 3490483..3490860 (-) 378 WP_060562617.1 competence type IV pilus minor pilin ComGG Machinery gene
  KOM03_RS16975 (KOM03_16975) comGF 3490861..3491361 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  KOM03_RS16980 (KOM03_16980) comGE 3491270..3491584 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  KOM03_RS16985 (KOM03_16985) comGD 3491568..3492005 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=575490 KOM03_RS16935 WP_003153105.1 3486953..3487126(+) (sinI) [Bacillus velezensis strain GMEKP1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=575490 KOM03_RS16935 WP_003153105.1 3486953..3487126(+) (sinI) [Bacillus velezensis strain GMEKP1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702