Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG25_RS00715 Genome accession   NZ_CP094121
Coordinates   155231..155356 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe059     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 150231..160356
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG25_RS00690 (MPG25_00690) - 150294..152513 (+) 2220 WP_245018816.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG25_RS00695 (MPG25_00695) panD 152503..152853 (+) 351 WP_180580766.1 aspartate 1-decarboxylase -
  MPG25_RS00700 (MPG25_00700) - 152864..153157 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG25_RS00705 (MPG25_00705) - 153157..154152 (+) 996 WP_245019124.1 PDZ domain-containing protein -
  MPG25_RS00710 (MPG25_00710) comB6 154160..155215 (+) 1056 WP_245019125.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG25_RS00715 (MPG25_00715) comB7 155231..155356 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG25_RS00720 (MPG25_00720) comB8 155353..156096 (+) 744 WP_000660529.1 virB8 family protein Machinery gene
  MPG25_RS00725 (MPG25_00725) comB9 156096..157058 (+) 963 WP_245018817.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG25_RS00730 (MPG25_00730) comB10 157051..158190 (+) 1140 WP_245018818.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG25_RS00735 (MPG25_00735) - 158256..159668 (+) 1413 WP_245018819.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=575431 MPG25_RS00715 WP_001217874.1 155231..155356(+) (comB7) [Helicobacter pylori strain Hpfe059]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=575431 MPG25_RS00715 WP_001217874.1 155231..155356(+) (comB7) [Helicobacter pylori strain Hpfe059]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878