Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   JNUCC22_RS01960 Genome accession   NZ_CP076408
Coordinates   390592..390711 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus sp. JNUCC-22     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 385592..395711
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JNUCC22_RS01945 (JNUCC22_01945) - 387204..387887 (+) 684 WP_216062087.1 response regulator transcription factor -
  JNUCC22_RS01950 (JNUCC22_01950) - 387874..389307 (+) 1434 WP_216062088.1 HAMP domain-containing sensor histidine kinase -
  JNUCC22_RS01955 (JNUCC22_01955) rapC 389460..390608 (+) 1149 WP_029326229.1 Rap family tetratricopeptide repeat protein Regulator
  JNUCC22_RS01960 (JNUCC22_01960) phrC 390592..390711 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  JNUCC22_RS01965 (JNUCC22_01965) - 390860..390955 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  JNUCC22_RS01970 (JNUCC22_01970) - 391050..392414 (-) 1365 WP_059366589.1 aspartate kinase -
  JNUCC22_RS01975 (JNUCC22_01975) ceuB 392828..393781 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  JNUCC22_RS01980 (JNUCC22_01980) - 393771..394718 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  JNUCC22_RS01985 (JNUCC22_01985) - 394712..395470 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=575028 JNUCC22_RS01960 WP_003156334.1 390592..390711(+) (phrC) [Bacillus sp. JNUCC-22]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=575028 JNUCC22_RS01960 WP_003156334.1 390592..390711(+) (phrC) [Bacillus sp. JNUCC-22]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718