Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   KM843_RS11650 Genome accession   NZ_CP076291
Coordinates   2426033..2426410 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain US1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2421033..2431410
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KM843_RS11610 (KM843_11610) - 2421531..2422325 (+) 795 WP_012117976.1 YqhG family protein -
  KM843_RS11615 (KM843_11615) sinI 2422502..2422675 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KM843_RS11620 (KM843_11620) sinR 2422709..2423044 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KM843_RS11625 (KM843_11625) tasA 2423092..2423877 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KM843_RS11630 (KM843_11630) sipW 2423942..2424526 (-) 585 WP_012117977.1 signal peptidase I SipW -
  KM843_RS11635 (KM843_11635) tapA 2424498..2425169 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  KM843_RS11640 (KM843_11640) - 2425428..2425757 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  KM843_RS11645 (KM843_11645) - 2425797..2425976 (-) 180 WP_003153093.1 YqzE family protein -
  KM843_RS11650 (KM843_11650) comGG 2426033..2426410 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  KM843_RS11655 (KM843_11655) comGF 2426411..2426911 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  KM843_RS11660 (KM843_11660) comGE 2426820..2427134 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  KM843_RS11665 (KM843_11665) comGD 2427118..2427555 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  KM843_RS11670 (KM843_11670) comGC 2427545..2427853 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KM843_RS11675 (KM843_11675) comGB 2427858..2428895 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  KM843_RS11680 (KM843_11680) comGA 2428882..2429952 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  KM843_RS11685 (KM843_11685) - 2430149..2431099 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=574545 KM843_RS11650 WP_012117980.1 2426033..2426410(-) (comGG) [Bacillus velezensis strain US1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=574545 KM843_RS11650 WP_012117980.1 2426033..2426410(-) (comGG) [Bacillus velezensis strain US1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512