Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   KM776_RS13120 Genome accession   NZ_CP076290
Coordinates   2675658..2676095 (-) Length   145 a.a.
NCBI ID   WP_003153088.1    Uniprot ID   -
Organism   Bacillus velezensis strain Q12     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2670658..2681095
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KM776_RS13070 (KM776_13070) sinI 2671043..2671216 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KM776_RS13075 (KM776_13075) sinR 2671250..2671585 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KM776_RS13080 (KM776_13080) tasA 2671633..2672418 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  KM776_RS13085 (KM776_13085) sipW 2672482..2673066 (-) 585 WP_003153100.1 signal peptidase I SipW -
  KM776_RS13090 (KM776_13090) tapA 2673038..2673709 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  KM776_RS13095 (KM776_13095) - 2673968..2674297 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KM776_RS13100 (KM776_13100) - 2674337..2674516 (-) 180 WP_003153093.1 YqzE family protein -
  KM776_RS13105 (KM776_13105) comGG 2674573..2674950 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  KM776_RS13110 (KM776_13110) comGF 2674951..2675451 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  KM776_RS13115 (KM776_13115) comGE 2675360..2675674 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  KM776_RS13120 (KM776_13120) comGD 2675658..2676095 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  KM776_RS13125 (KM776_13125) comGC 2676085..2676393 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KM776_RS13130 (KM776_13130) comGB 2676398..2677435 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  KM776_RS13135 (KM776_13135) comGA 2677422..2678492 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  KM776_RS13140 (KM776_13140) - 2678684..2679634 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -
  KM776_RS13145 (KM776_13145) - 2679780..2681081 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16324.85 Da        Isoelectric Point: 10.3725

>NTDB_id=574472 KM776_RS13120 WP_003153088.1 2675658..2676095(-) (comGD) [Bacillus velezensis strain Q12]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPREHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=574472 KM776_RS13120 WP_003153088.1 2675658..2676095(-) (comGD) [Bacillus velezensis strain Q12]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAGAGAGCATAAATACAAA
CTGCAGTCAGCCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552