Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KM776_RS13070 Genome accession   NZ_CP076290
Coordinates   2671043..2671216 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Q12     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2666043..2676216
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KM776_RS13055 (KM776_13055) gcvT 2666860..2667960 (-) 1101 WP_024085597.1 glycine cleavage system aminomethyltransferase GcvT -
  KM776_RS13060 (KM776_13060) - 2668384..2670054 (+) 1671 WP_069013074.1 SNF2-related protein -
  KM776_RS13065 (KM776_13065) - 2670072..2670866 (+) 795 WP_003153106.1 YqhG family protein -
  KM776_RS13070 (KM776_13070) sinI 2671043..2671216 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KM776_RS13075 (KM776_13075) sinR 2671250..2671585 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KM776_RS13080 (KM776_13080) tasA 2671633..2672418 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  KM776_RS13085 (KM776_13085) sipW 2672482..2673066 (-) 585 WP_003153100.1 signal peptidase I SipW -
  KM776_RS13090 (KM776_13090) tapA 2673038..2673709 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  KM776_RS13095 (KM776_13095) - 2673968..2674297 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KM776_RS13100 (KM776_13100) - 2674337..2674516 (-) 180 WP_003153093.1 YqzE family protein -
  KM776_RS13105 (KM776_13105) comGG 2674573..2674950 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  KM776_RS13110 (KM776_13110) comGF 2674951..2675451 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  KM776_RS13115 (KM776_13115) comGE 2675360..2675674 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  KM776_RS13120 (KM776_13120) comGD 2675658..2676095 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=574469 KM776_RS13070 WP_003153105.1 2671043..2671216(+) (sinI) [Bacillus velezensis strain Q12]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=574469 KM776_RS13070 WP_003153105.1 2671043..2671216(+) (sinI) [Bacillus velezensis strain Q12]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702