Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | G8O88_RS10930 | Genome accession | NZ_CP076051 |
| Coordinates | 2156825..2157307 (+) | Length | 160 a.a. |
| NCBI ID | WP_014601507.1 | Uniprot ID | A0AAN2XYP2 |
| Organism | Listeria monocytogenes strain 3BS90 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2141549..2189617 | 2156825..2157307 | within | 0 |
Gene organization within MGE regions
Location: 2141549..2189617
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8O88_RS10770 | - | 2141549..2141896 (+) | 348 | WP_003739618.1 | helix-turn-helix domain-containing protein | - |
| G8O88_RS10775 | - | 2141951..2142427 (-) | 477 | WP_039177531.1 | competence protein ComK | - |
| G8O88_RS10780 | - | 2142418..2143776 (-) | 1359 | WP_003733644.1 | recombinase family protein | - |
| G8O88_RS10785 | - | 2143853..2144740 (-) | 888 | WP_003733643.1 | hypothetical protein | - |
| G8O88_RS10790 | - | 2145134..2146081 (-) | 948 | WP_046421637.1 | hypothetical protein | - |
| G8O88_RS10795 | - | 2146120..2146542 (-) | 423 | WP_003749252.1 | hypothetical protein | - |
| G8O88_RS10800 | - | 2146555..2147160 (-) | 606 | WP_003733641.1 | hypothetical protein | - |
| G8O88_RS10805 | - | 2147176..2147601 (-) | 426 | WP_046421633.1 | ImmA/IrrE family metallo-endopeptidase | - |
| G8O88_RS10810 | - | 2147617..2148039 (-) | 423 | WP_031641587.1 | helix-turn-helix domain-containing protein | - |
| G8O88_RS10815 | - | 2148195..2148428 (+) | 234 | WP_046421628.1 | helix-turn-helix transcriptional regulator | - |
| G8O88_RS10820 | - | 2148432..2148653 (+) | 222 | WP_046421627.1 | hypothetical protein | - |
| G8O88_RS10825 | - | 2148650..2148907 (-) | 258 | WP_046421625.1 | hypothetical protein | - |
| G8O88_RS10830 | - | 2148972..2149148 (+) | 177 | WP_003769999.1 | hypothetical protein | - |
| G8O88_RS10835 | - | 2149165..2149320 (+) | 156 | WP_003769998.1 | hypothetical protein | - |
| G8O88_RS10840 | - | 2149322..2149489 (-) | 168 | WP_015967158.1 | hypothetical protein | - |
| G8O88_RS10845 | - | 2149556..2149750 (+) | 195 | WP_003727745.1 | hypothetical protein | - |
| G8O88_RS10850 | - | 2149762..2149998 (+) | 237 | WP_031660002.1 | hypothetical protein | - |
| G8O88_RS10855 | - | 2149995..2150162 (+) | 168 | WP_003725093.1 | hypothetical protein | - |
| G8O88_RS10860 | - | 2150163..2150366 (-) | 204 | WP_003725092.1 | KTSC domain-containing protein | - |
| G8O88_RS10865 | - | 2150430..2151203 (+) | 774 | WP_003747301.1 | phage repressor protein/antirepressor Ant | - |
| G8O88_RS10870 | - | 2151324..2151857 (+) | 534 | WP_009930464.1 | hypothetical protein | - |
| G8O88_RS10875 | - | 2151854..2152069 (+) | 216 | WP_003769990.1 | hypothetical protein | - |
| G8O88_RS10880 | - | 2152177..2152365 (+) | 189 | WP_003769989.1 | gp45 family putative tail fiber system protein | - |
| G8O88_RS14550 | - | 2152444..2152572 (+) | 129 | WP_009930468.1 | hypothetical protein | - |
| G8O88_RS10885 | - | 2152667..2152861 (+) | 195 | WP_009930470.1 | hypothetical protein | - |
| G8O88_RS10890 | - | 2152858..2153334 (+) | 477 | WP_009930471.1 | siphovirus Gp157 family protein | - |
| G8O88_RS10895 | - | 2153339..2153977 (+) | 639 | WP_009930473.1 | ERF family protein | - |
| G8O88_RS10900 | - | 2153991..2154914 (+) | 924 | WP_046421613.1 | DnaD domain-containing protein | - |
| G8O88_RS10905 | - | 2154911..2155366 (+) | 456 | WP_077918689.1 | class I SAM-dependent methyltransferase | - |
| G8O88_RS10910 | - | 2155371..2155931 (+) | 561 | WP_014601511.1 | DUF1642 domain-containing protein | - |
| G8O88_RS10915 | - | 2155990..2156391 (+) | 402 | WP_014601510.1 | hypothetical protein | - |
| G8O88_RS10920 | - | 2156388..2156597 (+) | 210 | WP_014601509.1 | hypothetical protein | - |
| G8O88_RS10925 | - | 2156598..2156756 (+) | 159 | WP_014601508.1 | hypothetical protein | - |
| G8O88_RS10930 | ssbA | 2156825..2157307 (+) | 483 | WP_014601507.1 | single-stranded DNA-binding protein | Machinery gene |
| G8O88_RS10935 | - | 2157326..2157508 (+) | 183 | WP_003733721.1 | hypothetical protein | - |
| G8O88_RS10940 | - | 2157498..2157995 (+) | 498 | WP_003733720.1 | Holliday junction resolvase RecU | - |
| G8O88_RS10945 | - | 2158060..2158512 (+) | 453 | WP_014601506.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| G8O88_RS10950 | - | 2158854..2159135 (+) | 282 | WP_231854893.1 | hypothetical protein | - |
| G8O88_RS10960 | - | 2159324..2160193 (+) | 870 | WP_014601504.1 | terminase small subunit | - |
| G8O88_RS10965 | - | 2160129..2161448 (+) | 1320 | WP_014930196.1 | PBSX family phage terminase large subunit | - |
| G8O88_RS10970 | - | 2161463..2163019 (+) | 1557 | WP_014601502.1 | hypothetical protein | - |
| G8O88_RS10975 | - | 2163024..2164067 (+) | 1044 | WP_014930195.1 | phage minor capsid protein | - |
| G8O88_RS10980 | - | 2164163..2164717 (+) | 555 | WP_003744996.1 | hypothetical protein | - |
| G8O88_RS10985 | - | 2164740..2165612 (+) | 873 | WP_014930194.1 | hypothetical protein | - |
| G8O88_RS10990 | - | 2165626..2165805 (+) | 180 | WP_014930193.1 | hypothetical protein | - |
| G8O88_RS10995 | - | 2165806..2166159 (+) | 354 | WP_003745003.1 | hypothetical protein | - |
| G8O88_RS11000 | - | 2166159..2166524 (+) | 366 | WP_046421583.1 | hypothetical protein | - |
| G8O88_RS11005 | - | 2166514..2166831 (+) | 318 | WP_046421581.1 | HK97 gp10 family phage protein | - |
| G8O88_RS11010 | - | 2166828..2167199 (+) | 372 | WP_003745007.1 | hypothetical protein | - |
| G8O88_RS11015 | - | 2167204..2167890 (+) | 687 | WP_014930190.1 | phage tail tube protein | - |
| G8O88_RS11020 | - | 2167946..2168377 (+) | 432 | WP_003725062.1 | hypothetical protein | - |
| G8O88_RS11025 | - | 2168395..2168685 (+) | 291 | WP_039380722.1 | Gp15 family bacteriophage protein | - |
| G8O88_RS11030 | - | 2168690..2173489 (+) | 4800 | WP_046421573.1 | phage tail tape measure protein | - |
| G8O88_RS11035 | - | 2173486..2175054 (+) | 1569 | WP_026747248.1 | distal tail protein Dit | - |
| G8O88_RS11040 | - | 2175067..2177232 (+) | 2166 | WP_014601493.1 | phage tail spike protein | - |
| G8O88_RS11045 | - | 2177283..2177585 (+) | 303 | WP_014930187.1 | hypothetical protein | - |
| G8O88_RS11050 | - | 2177585..2177851 (+) | 267 | WP_003733521.1 | phage holin | - |
| G8O88_RS11055 | - | 2177851..2178696 (+) | 846 | WP_014930186.1 | DUF5776 domain-containing protein | - |
| G8O88_RS11060 | - | 2178799..2179797 (+) | 999 | WP_039153008.1 | DUF3644 domain-containing protein | - |
| G8O88_RS11065 | - | 2180003..2180503 (-) | 501 | WP_014601490.1 | AP2 domain-containing protein | - |
| G8O88_RS11070 | - | 2180500..2180931 (-) | 432 | WP_014601489.1 | helix-turn-helix transcriptional regulator | - |
| G8O88_RS11075 | - | 2180933..2181334 (-) | 402 | WP_014601488.1 | hypothetical protein | - |
| G8O88_RS11080 | - | 2181499..2181798 (-) | 300 | Protein_2173 | competence protein ComK | - |
| G8O88_RS11085 | - | 2181929..2182285 (+) | 357 | WP_003723667.1 | IDEAL domain-containing protein | - |
| G8O88_RS11090 | addB | 2182435..2185908 (+) | 3474 | WP_031674771.1 | helicase-exonuclease AddAB subunit AddB | - |
| G8O88_RS11095 | addA | 2185910..2189617 (+) | 3708 | WP_014601063.1 | helicase-exonuclease AddAB subunit AddA | - |
Sequence
Protein
Download Length: 160 a.a. Molecular weight: 17649.45 Da Isoelectric Point: 4.9821
>NTDB_id=571710 G8O88_RS10930 WP_014601507.1 2156825..2157307(+) (ssbA) [Listeria monocytogenes strain 3BS90]
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRPFKNGQGEQEADFIQCVVWRKPAENVANFLKKGSLTGVDGRVQTR
NYEGNDGKRVYVTEIVAESVQFLEPKQNAVEGSTPNNNQNEANYSNNNKNGSYRASSSQNSDSFANEGKPIDISDDDLPF
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRPFKNGQGEQEADFIQCVVWRKPAENVANFLKKGSLTGVDGRVQTR
NYEGNDGKRVYVTEIVAESVQFLEPKQNAVEGSTPNNNQNEANYSNNNKNGSYRASSSQNSDSFANEGKPIDISDDDLPF
Nucleotide
Download Length: 483 bp
>NTDB_id=571710 G8O88_RS10930 WP_014601507.1 2156825..2157307(+) (ssbA) [Listeria monocytogenes strain 3BS90]
ATGATGAATCGTGTCGTGCTCGTAGGACGTTTAACTAAAGATCCAGAGCTAAGATATACGCCAGCGGGTGTAGCAGTTGC
GACTTTTACACTTGCTGTCAATCGACCTTTTAAAAACGGGCAAGGAGAACAAGAAGCTGATTTTATTCAATGTGTTGTTT
GGCGTAAACCAGCAGAAAACGTCGCTAATTTCTTAAAAAAAGGAAGTTTAACAGGCGTTGATGGTCGCGTTCAAACTCGT
AACTATGAGGGGAACGACGGTAAGCGCGTTTATGTGACGGAAATAGTGGCCGAGAGTGTTCAATTTTTGGAACCTAAGCA
GAACGCTGTAGAAGGCTCTACACCGAATAATAATCAAAACGAAGCTAATTATTCAAATAACAATAAAAACGGCTCATATC
GAGCTAGTTCGAGCCAGAATAGTGATTCATTTGCAAACGAAGGTAAGCCGATTGATATTTCAGATGACGATTTGCCATTT
TGA
ATGATGAATCGTGTCGTGCTCGTAGGACGTTTAACTAAAGATCCAGAGCTAAGATATACGCCAGCGGGTGTAGCAGTTGC
GACTTTTACACTTGCTGTCAATCGACCTTTTAAAAACGGGCAAGGAGAACAAGAAGCTGATTTTATTCAATGTGTTGTTT
GGCGTAAACCAGCAGAAAACGTCGCTAATTTCTTAAAAAAAGGAAGTTTAACAGGCGTTGATGGTCGCGTTCAAACTCGT
AACTATGAGGGGAACGACGGTAAGCGCGTTTATGTGACGGAAATAGTGGCCGAGAGTGTTCAATTTTTGGAACCTAAGCA
GAACGCTGTAGAAGGCTCTACACCGAATAATAATCAAAACGAAGCTAATTATTCAAATAACAATAAAAACGGCTCATATC
GAGCTAGTTCGAGCCAGAATAGTGATTCATTTGCAAACGAAGGTAAGCCGATTGATATTTCAGATGACGATTTGCCATTT
TGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
63.953 |
100 |
0.687 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.706 |
100 |
0.581 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
63.208 |
66.25 |
0.419 |