Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   G8O85_RS12250 Genome accession   NZ_CP075876
Coordinates   2413166..2413648 (+) Length   160 a.a.
NCBI ID   WP_026750207.1    Uniprot ID   -
Organism   Listeria monocytogenes strain 3BS28     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2403062..2449408 2413166..2413648 within 0


Gene organization within MGE regions


Location: 2403062..2449408
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G8O85_RS12145 - 2403062..2403298 (+) 237 WP_026750220.1 hypothetical protein -
  G8O85_RS12150 - 2403295..2403576 (+) 282 WP_012951961.1 hypothetical protein -
  G8O85_RS12155 - 2403578..2403775 (-) 198 WP_003733684.1 hypothetical protein -
  G8O85_RS15100 - 2404393..2404470 (+) 78 Protein_2392 hypothetical protein -
  G8O85_RS12160 - 2404452..2405231 (+) 780 WP_026750219.1 phage antirepressor KilAC domain-containing protein -
  G8O85_RS12165 - 2405357..2405890 (+) 534 WP_012951959.1 hypothetical protein -
  G8O85_RS12170 - 2405887..2406102 (+) 216 WP_023548459.1 hypothetical protein -
  G8O85_RS12175 - 2406211..2406399 (+) 189 WP_003722564.1 gp45 family putative tail fiber system protein -
  G8O85_RS15105 - 2406481..2406609 (+) 129 WP_003743356.1 hypothetical protein -
  G8O85_RS12180 - 2406705..2406899 (+) 195 WP_003734953.1 hypothetical protein -
  G8O85_RS12185 - 2406896..2407372 (+) 477 WP_012951957.1 siphovirus Gp157 family protein -
  G8O85_RS12190 - 2407378..2408037 (+) 660 WP_026750218.1 ERF family protein -
  G8O85_RS12195 - 2408054..2409028 (+) 975 WP_026750217.1 phage replisome organizer N-terminal domain-containing protein -
  G8O85_RS12200 - 2409025..2409489 (+) 465 WP_026750216.1 class I SAM-dependent methyltransferase -
  G8O85_RS12205 - 2409489..2410472 (+) 984 WP_026750215.1 DNA cytosine methyltransferase -
  G8O85_RS12210 - 2410469..2410846 (+) 378 WP_026750214.1 hypothetical protein -
  G8O85_RS12215 - 2410843..2411400 (+) 558 WP_026750213.1 DUF1642 domain-containing protein -
  G8O85_RS12220 - 2411397..2411585 (+) 189 WP_026750212.1 hypothetical protein -
  G8O85_RS12225 - 2411582..2411821 (+) 240 WP_200644341.1 hypothetical protein -
  G8O85_RS12230 - 2411802..2412137 (+) 336 WP_026750211.1 hypothetical protein -
  G8O85_RS12235 - 2412130..2412390 (+) 261 WP_026750210.1 DUF3850 domain-containing protein -
  G8O85_RS12240 - 2412412..2412771 (+) 360 WP_026750209.1 hypothetical protein -
  G8O85_RS12245 - 2412768..2413169 (+) 402 WP_026750208.1 hypothetical protein -
  G8O85_RS12250 ssbA 2413166..2413648 (+) 483 WP_026750207.1 single-stranded DNA-binding protein Machinery gene
  G8O85_RS12255 - 2413667..2413849 (+) 183 WP_031669838.1 hypothetical protein -
  G8O85_RS12260 - 2413794..2414198 (+) 405 WP_026750206.1 DUF1064 domain-containing protein -
  G8O85_RS12265 - 2414202..2414585 (+) 384 WP_026750205.1 DUF2481 family protein -
  G8O85_RS15110 - 2414578..2414703 (+) 126 WP_256380165.1 hypothetical protein -
  G8O85_RS12270 - 2414726..2415160 (+) 435 WP_026750204.1 ArpU family phage packaging/lysis transcriptional regulator -
  G8O85_RS12275 - 2415342..2415974 (+) 633 WP_015987428.1 hypothetical protein -
  G8O85_RS12280 - 2416055..2416282 (+) 228 WP_012951944.1 hypothetical protein -
  G8O85_RS12285 terS 2416322..2417107 (+) 786 WP_026750203.1 phage terminase small subunit -
  G8O85_RS12290 - 2417046..2418365 (+) 1320 WP_054314420.1 PBSX family phage terminase large subunit -
  G8O85_RS12295 - 2418380..2419936 (+) 1557 WP_026750201.1 hypothetical protein -
  G8O85_RS12300 - 2419941..2420984 (+) 1044 WP_003753503.1 phage minor capsid protein -
  G8O85_RS12305 - 2421080..2421634 (+) 555 WP_003744996.1 hypothetical protein -
  G8O85_RS12310 - 2421657..2422529 (+) 873 WP_026750200.1 hypothetical protein -
  G8O85_RS12315 - 2422549..2422716 (+) 168 WP_176936674.1 hypothetical protein -
  G8O85_RS12320 - 2422717..2423070 (+) 354 WP_003723785.1 hypothetical protein -
  G8O85_RS12325 - 2423070..2423435 (+) 366 WP_026750199.1 hypothetical protein -
  G8O85_RS12330 - 2423425..2423742 (+) 318 WP_012951936.1 HK97 gp10 family phage protein -
  G8O85_RS12335 - 2423739..2424110 (+) 372 WP_003725064.1 hypothetical protein -
  G8O85_RS12340 - 2424115..2424801 (+) 687 WP_012951935.1 phage tail tube protein -
  G8O85_RS12345 - 2424857..2425288 (+) 432 WP_026750198.1 hypothetical protein -
  G8O85_RS12350 - 2425321..2425596 (+) 276 WP_026750197.1 Gp15 family bacteriophage protein -
  G8O85_RS12355 - 2425601..2430400 (+) 4800 WP_054314419.1 phage tail tape measure protein -
  G8O85_RS12360 - 2430397..2431965 (+) 1569 WP_026747248.1 distal tail protein Dit -
  G8O85_RS12365 - 2431978..2434140 (+) 2163 WP_058877366.1 phage tail spike protein -
  G8O85_RS12370 - 2434192..2434497 (+) 306 WP_003733957.1 hypothetical protein -
  G8O85_RS12375 - 2434494..2434778 (+) 285 WP_223196619.1 phage holin -
  G8O85_RS12380 - 2434778..2435623 (+) 846 WP_054314418.1 DUF5776 domain-containing protein -
  G8O85_RS12385 - 2435862..2436038 (+) 177 WP_003733956.1 hypothetical protein -
  G8O85_RS12390 - 2436025..2436624 (+) 600 WP_003723292.1 N-acetyltransferase -
  G8O85_RS12395 acrIIA1 2436696..2437145 (-) 450 WP_047933338.1 anti-CRISPR protein AcrIIA1 -
  G8O85_RS12400 - 2437150..2437500 (-) 351 WP_012581437.1 AcrIIA2 family anti-CRISPR protein -
  G8O85_RS12405 acrIIA3 2437532..2437909 (-) 378 WP_012581436.1 anti-CRISPR protein AcrIIA3 -
  G8O85_RS12410 - 2438015..2438224 (-) 210 WP_003727805.1 hypothetical protein -
  G8O85_RS12415 - 2438664..2438897 (+) 234 WP_047934317.1 hypothetical protein -
  G8O85_RS15115 - 2438894..2439091 (+) 198 WP_054314417.1 hypothetical protein -
  G8O85_RS12420 - 2439092..2439371 (-) 280 Protein_2448 competence protein ComK -
  G8O85_RS12425 - 2439502..2439858 (+) 357 WP_003723667.1 IDEAL domain-containing protein -
  G8O85_RS12430 addB 2440008..2443481 (+) 3474 WP_054314416.1 helicase-exonuclease AddAB subunit AddB -
  G8O85_RS12435 addA 2443483..2447190 (+) 3708 WP_010989936.1 helicase-exonuclease AddAB subunit AddA -
  G8O85_RS12440 - 2447191..2448039 (+) 849 WP_009930518.1 fumarylacetoacetate hydrolase family protein -
  G8O85_RS12445 - 2448060..2448422 (+) 363 WP_031644701.1 YisL family protein -
  G8O85_RS12450 - 2448506..2449408 (+) 903 WP_003723662.1 YitT family protein -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 17745.53 Da        Isoelectric Point: 5.2853

>NTDB_id=570578 G8O85_RS12250 WP_026750207.1 2413166..2413648(+) (ssbA) [Listeria monocytogenes strain 3BS28]
MMNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRTFTNQNGEREADFINCVVWRKPAENVANFLKKGSVAGVDGRVQTR
NYEDNDGKRVFVTEVVAESVQFLEPKNNNVEGATSNNYQNKANYSNNNQTSSYRADTSQKSDSFASEGKPIDINPDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=570578 G8O85_RS12250 WP_026750207.1 2413166..2413648(+) (ssbA) [Listeria monocytogenes strain 3BS28]
ATGATGAATCGTGTAGTACTTGTAGGACGATTAACAAAAGATCCGGATTTACGTTACACTCCAGCAGGCGCGGCTGTTGC
GACTTTTACATTAGCAGTAAATAGAACATTCACTAATCAGAATGGAGAACGAGAAGCCGACTTTATTAATTGTGTTGTTT
GGCGTAAACCAGCGGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCGTGGCGGGCGTTGATGGACGTGTTCAAACTCGA
AATTACGAAGATAACGACGGTAAACGTGTTTTCGTTACAGAAGTAGTAGCTGAATCAGTTCAATTCTTAGAACCTAAAAA
CAACAACGTAGAAGGTGCTACATCGAATAATTACCAAAACAAGGCTAATTATTCAAATAACAATCAAACAAGCTCATATC
GAGCGGATACGAGCCAGAAGAGTGATTCATTTGCAAGTGAAGGTAAGCCGATTGATATTAATCCGGATGATTTGCCATTT
TGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.698

100

0.706
  ssb Latilactobacillus sakei subsp. sakei 23K

55.882

100

0.594
  ssbB Bacillus subtilis subsp. subtilis str. 168

64.151

66.25

0.425