Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   G8O85_RS11010 Genome accession   NZ_CP075876
Coordinates   2185771..2186250 (-) Length   159 a.a.
NCBI ID   WP_200644348.1    Uniprot ID   -
Organism   Listeria monocytogenes strain 3BS28     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2159784..2194542 2185771..2186250 within 0


Gene organization within MGE regions


Location: 2159784..2194542
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G8O85_RS10835 - 2159784..2160017 (+) 234 WP_003731277.1 hypothetical protein -
  G8O85_RS10840 - 2160049..2160300 (+) 252 WP_003731276.1 hypothetical protein -
  G8O85_RS10845 acrIIA1 2160301..2160750 (+) 450 WP_003722518.1 anti-CRISPR protein AcrIIA1 -
  G8O85_RS10850 - 2160775..2161272 (+) 498 WP_003733661.1 AP2 domain-containing protein -
  G8O85_RS10855 - 2161532..2162320 (+) 789 WP_003733662.1 DUF3825 domain-containing protein -
  G8O85_RS10860 - 2162361..2163206 (-) 846 WP_200644351.1 DUF5776 domain-containing protein -
  G8O85_RS10865 - 2163206..2163472 (-) 267 WP_003733521.1 phage holin -
  G8O85_RS10870 - 2163472..2163774 (-) 303 WP_039177480.1 hypothetical protein -
  G8O85_RS10875 - 2163815..2163973 (-) 159 WP_003722524.1 CD1375 family protein -
  G8O85_RS10880 - 2163978..2164295 (-) 318 WP_003722525.1 hypothetical protein -
  G8O85_RS10885 - 2164307..2165380 (-) 1074 WP_039120293.1 phage baseplate upper protein -
  G8O85_RS10890 - 2165380..2166408 (-) 1029 WP_003722527.1 hypothetical protein -
  G8O85_RS10895 - 2166409..2167434 (-) 1026 WP_096824806.1 phage tail protein -
  G8O85_RS10900 - 2167443..2168261 (-) 819 WP_096824805.1 phage tail family protein -
  G8O85_RS10905 - 2168263..2173626 (-) 5364 WP_096824804.1 tape measure protein -
  G8O85_RS10910 - 2173637..2174242 (-) 606 WP_064034180.1 bacteriophage Gp15 family protein -
  G8O85_RS10915 - 2174248..2174670 (-) 423 WP_003731739.1 phage tail assembly chaperone -
  G8O85_RS10920 - 2174722..2174961 (-) 240 WP_070003081.1 Ig-like domain-containing protein -
  G8O85_RS10925 - 2174984..2175421 (-) 438 WP_096824803.1 phage tail tube protein -
  G8O85_RS10930 - 2175424..2175831 (-) 408 WP_010679811.1 minor capsid protein -
  G8O85_RS10935 - 2175831..2176169 (-) 339 WP_031644586.1 minor capsid protein -
  G8O85_RS10940 - 2176169..2176531 (-) 363 WP_015967146.1 minor capsid protein -
  G8O85_RS10945 - 2176531..2176926 (-) 396 WP_015967145.1 hypothetical protein -
  G8O85_RS10950 - 2176928..2177086 (-) 159 WP_010679815.1 HeH/LEM domain-containing protein -
  G8O85_RS10955 - 2177086..2177985 (-) 900 WP_015967144.1 phage major capsid protein -
  G8O85_RS10960 - 2178009..2178578 (-) 570 WP_015967143.1 phage scaffolding protein -
  G8O85_RS10965 - 2178657..2179796 (-) 1140 WP_200644350.1 phage minor capsid protein -
  G8O85_RS10970 - 2179797..2181557 (-) 1761 WP_200644349.1 phage portal protein -
  G8O85_RS10975 - 2181570..2182901 (-) 1332 WP_003769961.1 PBSX family phage terminase large subunit -
  G8O85_RS10980 - 2182870..2183412 (-) 543 WP_003769962.1 terminase small subunit -
  G8O85_RS10985 - 2183452..2183751 (-) 300 WP_003769963.1 hypothetical protein -
  G8O85_RS10990 - 2184348..2184782 (-) 435 WP_003769964.1 ArpU family phage packaging/lysis transcriptional regulator -
  G8O85_RS15085 - 2184809..2184934 (-) 126 WP_003769965.1 hypothetical protein -
  G8O85_RS10995 - 2184927..2185331 (-) 405 WP_003769966.1 endodeoxyribonuclease -
  G8O85_RS11000 - 2185297..2185437 (-) 141 WP_014601286.1 BH0509 family protein -
  G8O85_RS11005 - 2185434..2185739 (-) 306 WP_031641288.1 hypothetical protein -
  G8O85_RS11010 ssbA 2185771..2186250 (-) 480 WP_200644348.1 single-stranded DNA-binding protein Machinery gene
  G8O85_RS11015 - 2186247..2186576 (-) 330 WP_200644347.1 hypothetical protein -
  G8O85_RS11020 - 2186755..2187270 (-) 516 WP_070770809.1 hypothetical protein -
  G8O85_RS11025 - 2187329..2187889 (-) 561 WP_200644346.1 DUF1642 domain-containing protein -
  G8O85_RS11030 - 2187886..2188278 (-) 393 WP_003769978.1 hypothetical protein -
  G8O85_RS11035 - 2188275..2188484 (-) 210 WP_003769979.1 hypothetical protein -
  G8O85_RS15120 - 2188481..2188774 (-) 294 WP_003769981.1 hypothetical protein -
  G8O85_RS11040 - 2188780..2188947 (-) 168 WP_172633682.1 hypothetical protein -
  G8O85_RS11045 - 2188944..2189219 (-) 276 WP_200644345.1 hypothetical protein -
  G8O85_RS11050 - 2189234..2189404 (-) 171 WP_176715880.1 hypothetical protein -
  G8O85_RS11055 - 2189398..2190204 (-) 807 WP_058832616.1 ATP-binding protein -
  G8O85_RS11060 - 2190167..2190964 (-) 798 WP_069027951.1 DnaD domain-containing protein -
  G8O85_RS11065 - 2190976..2191635 (-) 660 WP_069027950.1 ERF family protein -
  G8O85_RS11070 - 2191641..2192117 (-) 477 WP_069027949.1 siphovirus Gp157 family protein -
  G8O85_RS11075 - 2192114..2192308 (-) 195 WP_003737363.1 hypothetical protein -
  G8O85_RS15090 - 2192403..2192531 (-) 129 WP_256090182.1 hypothetical protein -
  G8O85_RS11080 - 2192613..2192801 (-) 189 WP_003727753.1 gp45 family putative tail fiber system protein -
  G8O85_RS11085 - 2192904..2193110 (-) 207 WP_003733681.1 AlpA family transcriptional regulator -
  G8O85_RS11090 - 2193100..2193630 (-) 531 WP_096921209.1 hypothetical protein -
  G8O85_RS11095 - 2193754..2194542 (-) 789 WP_097529569.1 phage antirepressor KilAC domain-containing protein -

Sequence

Protein


Download         Length: 159 a.a.        Molecular weight: 17652.47 Da        Isoelectric Point: 5.2612

>NTDB_id=570577 G8O85_RS11010 WP_200644348.1 2185771..2186250(-) (ssbA) [Listeria monocytogenes strain 3BS28]
MMNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNAQGEQEADFINCVVWRKPAENVANFLKKGSMAGVDGRIQTR
NYEDNDGKRVFVTEVVAESVQFLEPRNHAEGATSNNYQNQANYSNNNQTSSYRADTSQKSDSFASEGKPIDINPDDLPF

Nucleotide


Download         Length: 480 bp        

>NTDB_id=570577 G8O85_RS11010 WP_200644348.1 2185771..2186250(-) (ssbA) [Listeria monocytogenes strain 3BS28]
ATGATGAATCGTGTAGTACTTGTAGGTCGATTAACTAAAGACCCTGATTTACGATATACGCCAGCAGGCGCGGCTGTTGC
GACTTTTACATTAGCTGTAAATCGCCCATTTAAAAATGCACAAGGAGAACAAGAAGCCGATTTCATTAATTGTGTTGTTT
GGCGAAAACCAGCGGAAAACGTTGCTAATTTCTTGAAAAAAGGAAGCATGGCAGGCGTTGATGGACGCATACAGACTCGA
AATTACGAAGATAACGACGGTAAACGCGTTTTCGTTACTGAGGTAGTTGCTGAATCAGTTCAATTCTTAGAGCCCAGAAA
CCACGCAGAAGGCGCTACATCGAATAATTACCAAAACCAAGCTAATTATTCAAATAACAATCAAACAAGCTCATATCGAG
CGGATACGAGTCAGAAGAGCGATTCATTTGCAAGTGAAGGTAAGCCGATTGATATTAATCCGGATGATTTGCCATTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

63.372

100

0.686
  ssb Latilactobacillus sakei subsp. sakei 23K

56.471

100

0.604
  ssbB Bacillus subtilis subsp. subtilis str. 168

63.393

70.44

0.447