Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | G8O85_RS05385 | Genome accession | NZ_CP075876 |
| Coordinates | 1060315..1060794 (-) | Length | 159 a.a. |
| NCBI ID | WP_031668909.1 | Uniprot ID | - |
| Organism | Listeria monocytogenes strain 3BS28 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1029676..1069788 | 1060315..1060794 | within | 0 |
Gene organization within MGE regions
Location: 1029676..1069788
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8O85_RS05220 | - | 1029676..1030326 (-) | 651 | WP_039385914.1 | transaldolase family protein | - |
| G8O85_RS05225 | - | 1030469..1031197 (-) | 729 | WP_009930760.1 | hypothetical protein | - |
| G8O85_RS05230 | - | 1031293..1033173 (-) | 1881 | WP_003722840.1 | heavy metal translocating P-type ATPase | - |
| G8O85_RS05235 | - | 1033439..1034356 (-) | 918 | WP_003732615.1 | aldo/keto reductase family oxidoreductase | - |
| G8O85_RS05240 | - | 1034420..1034953 (-) | 534 | WP_010989534.1 | DUF3267 domain-containing protein | - |
| G8O85_RS05245 | - | 1035593..1036222 (-) | 630 | WP_009912342.1 | hypothetical protein | - |
| G8O85_RS05255 | - | 1037426..1037872 (+) | 447 | WP_049955951.1 | hypothetical protein | - |
| G8O85_RS05260 | - | 1037946..1038773 (-) | 828 | WP_049955950.1 | N-acetylmuramoyl-L-alanine amidase | - |
| G8O85_RS05265 | - | 1038770..1039036 (-) | 267 | WP_031672590.1 | phage holin | - |
| G8O85_RS05270 | - | 1039057..1039473 (-) | 417 | WP_031672588.1 | hypothetical protein | - |
| G8O85_RS05275 | - | 1039452..1039895 (-) | 444 | WP_009928178.1 | hypothetical protein | - |
| G8O85_RS05280 | - | 1039943..1041007 (-) | 1065 | WP_031672587.1 | hypothetical protein | - |
| G8O85_RS05285 | - | 1041000..1043291 (-) | 2292 | WP_068998205.1 | phage tail spike protein | - |
| G8O85_RS05290 | - | 1043297..1045540 (-) | 2244 | WP_031672585.1 | distal tail protein Dit | - |
| G8O85_RS05295 | - | 1045533..1049636 (-) | 4104 | WP_227876235.1 | phage tail tape measure protein | - |
| G8O85_RS05300 | gpG | 1049929..1050276 (-) | 348 | WP_031669986.1 | phage tail assembly chaperone G | - |
| G8O85_RS05305 | - | 1050366..1050941 (-) | 576 | WP_031672582.1 | major tail protein | - |
| G8O85_RS05310 | - | 1050963..1051361 (-) | 399 | WP_031672580.1 | hypothetical protein | - |
| G8O85_RS05315 | - | 1051364..1051729 (-) | 366 | WP_012951328.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| G8O85_RS05320 | - | 1051723..1052043 (-) | 321 | WP_012951327.1 | phage head closure protein | - |
| G8O85_RS05325 | - | 1052013..1052351 (-) | 339 | WP_031672578.1 | head-tail connector protein | - |
| G8O85_RS05330 | - | 1052400..1053569 (-) | 1170 | WP_012951325.1 | phage major capsid protein | - |
| G8O85_RS05335 | - | 1053633..1054199 (-) | 567 | WP_012951324.1 | HK97 family phage prohead protease | - |
| G8O85_RS05340 | - | 1054196..1055431 (-) | 1236 | WP_012951323.1 | phage portal protein | - |
| G8O85_RS05345 | - | 1055434..1055634 (-) | 201 | WP_023552290.1 | DUF1056 family protein | - |
| G8O85_RS05350 | - | 1055641..1057368 (-) | 1728 | WP_023552288.1 | terminase large subunit | - |
| G8O85_RS05355 | - | 1057361..1057888 (-) | 528 | WP_012951321.1 | phage terminase small subunit P27 family | - |
| G8O85_RS15125 | - | 1057983..1058345 (-) | 363 | WP_023552287.1 | HNH endonuclease signature motif containing protein | - |
| G8O85_RS05365 | - | 1058342..1058668 (-) | 327 | WP_023552285.1 | hypothetical protein | - |
| G8O85_RS05370 | - | 1058952..1059494 (-) | 543 | WP_012951317.1 | tyrosine-type recombinase/integrase | - |
| G8O85_RS05375 | - | 1059491..1060009 (-) | 519 | WP_014930677.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| G8O85_RS05380 | - | 1060070..1060246 (-) | 177 | WP_223196704.1 | hypothetical protein | - |
| G8O85_RS05385 | ssbA | 1060315..1060794 (-) | 480 | WP_031668909.1 | single-stranded DNA-binding protein | Machinery gene |
| G8O85_RS05390 | - | 1060794..1061375 (-) | 582 | WP_049955949.1 | DUF3310 domain-containing protein | - |
| G8O85_RS05395 | - | 1061375..1061623 (-) | 249 | WP_031668907.1 | ASCH/PUA domain-containing protein | - |
| G8O85_RS05400 | - | 1061644..1062027 (-) | 384 | WP_023552263.1 | hypothetical protein | - |
| G8O85_RS05405 | - | 1062131..1062556 (-) | 426 | WP_031672575.1 | pentapeptide repeat-containing protein | - |
| G8O85_RS05410 | - | 1062574..1063119 (-) | 546 | WP_049955978.1 | DUF1642 domain-containing protein | - |
| G8O85_RS05415 | - | 1063116..1064099 (-) | 984 | WP_031672325.1 | DNA cytosine methyltransferase | - |
| G8O85_RS05420 | - | 1064187..1064363 (-) | 177 | WP_023552249.1 | hypothetical protein | - |
| G8O85_RS05425 | - | 1064360..1064776 (-) | 417 | WP_031672324.1 | hypothetical protein | - |
| G8O85_RS05430 | - | 1064773..1065129 (-) | 357 | WP_031668902.1 | MerR family transcriptional regulator | - |
| G8O85_RS05435 | - | 1065131..1066045 (-) | 915 | WP_031672323.1 | conserved phage C-terminal domain-containing protein | - |
| G8O85_RS05440 | - | 1066218..1066544 (-) | 327 | WP_012951301.1 | DUF771 domain-containing protein | - |
| G8O85_RS05445 | - | 1066642..1066833 (-) | 192 | WP_014930668.1 | helix-turn-helix transcriptional regulator | - |
| G8O85_RS05450 | - | 1066999..1067334 (+) | 336 | WP_223196651.1 | helix-turn-helix domain-containing protein | - |
| G8O85_RS05455 | - | 1067347..1067847 (+) | 501 | WP_031668899.1 | ImmA/IrrE family metallo-endopeptidase | - |
| G8O85_RS05460 | - | 1067902..1068615 (+) | 714 | WP_031668898.1 | lipoprotein | - |
| G8O85_RS05465 | - | 1068637..1069788 (+) | 1152 | WP_023552234.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 17461.36 Da Isoelectric Point: 5.2753
>NTDB_id=570559 G8O85_RS05385 WP_031668909.1 1060315..1060794(-) (ssbA) [Listeria monocytogenes strain 3BS28]
MMNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNAQGEQEADFINCVVWRKPAENVANFLKKGSMAGVDGRIQTR
NYEDNDGKRVFVTEVVAESVQFLEPKNNPGRATTNDYQSKANYSNNTQTSSYESGASQKGGAFVSDSKPIDISDDDLPF
MMNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNAQGEQEADFINCVVWRKPAENVANFLKKGSMAGVDGRIQTR
NYEDNDGKRVFVTEVVAESVQFLEPKNNPGRATTNDYQSKANYSNNTQTSSYESGASQKGGAFVSDSKPIDISDDDLPF
Nucleotide
Download Length: 480 bp
>NTDB_id=570559 G8O85_RS05385 WP_031668909.1 1060315..1060794(-) (ssbA) [Listeria monocytogenes strain 3BS28]
ATGATGAATCGTGTAGTACTTGTAGGTCGATTAACTAAAGACCCTGATTTACGATATACGCCAGCAGGCGCGGCTGTTGC
GACTTTTACATTAGCTGTAAATCGCCCATTTAAAAATGCACAAGGAGAACAAGAAGCCGATTTCATTAATTGTGTTGTTT
GGCGAAAACCAGCAGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCGGGCGTTGATGGTCGAATACAGACTCGA
AATTATGAGGACAACGACGGTAAACGCGTTTTTGTTACGGAAGTAGTTGCTGAATCAGTTCAATTCTTAGAGCCTAAAAA
CAACCCAGGGAGAGCTACAACGAATGATTATCAAAGCAAAGCTAATTATTCAAACAACACTCAAACAAGCTCATATGAAT
CGGGTGCGAGCCAGAAAGGCGGTGCGTTTGTTAGTGATAGCAAGCCAATCGATATTTCAGATGATGATTTGCCGTTTTAA
ATGATGAATCGTGTAGTACTTGTAGGTCGATTAACTAAAGACCCTGATTTACGATATACGCCAGCAGGCGCGGCTGTTGC
GACTTTTACATTAGCTGTAAATCGCCCATTTAAAAATGCACAAGGAGAACAAGAAGCCGATTTCATTAATTGTGTTGTTT
GGCGAAAACCAGCAGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCGGGCGTTGATGGTCGAATACAGACTCGA
AATTATGAGGACAACGACGGTAAACGCGTTTTTGTTACGGAAGTAGTTGCTGAATCAGTTCAATTCTTAGAGCCTAAAAA
CAACCCAGGGAGAGCTACAACGAATGATTATCAAAGCAAAGCTAATTATTCAAACAACACTCAAACAAGCTCATATGAAT
CGGGTGCGAGCCAGAAAGGCGGTGCGTTTGTTAGTGATAGCAAGCCAATCGATATTTCAGATGATGATTTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
63.953 |
100 |
0.692 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.857 |
100 |
0.604 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
66.981 |
66.667 |
0.447 |