Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | G8O84_RS02090 | Genome accession | NZ_CP075875 |
| Coordinates | 428154..428633 (+) | Length | 159 a.a. |
| NCBI ID | WP_031668909.1 | Uniprot ID | - |
| Organism | Listeria monocytogenes strain 2BR25 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 419160..459272 | 428154..428633 | within | 0 |
Gene organization within MGE regions
Location: 419160..459272
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8O84_RS02010 | - | 419160..420311 (-) | 1152 | WP_023552234.1 | site-specific integrase | - |
| G8O84_RS02015 | - | 420333..421046 (-) | 714 | WP_031668898.1 | lipoprotein | - |
| G8O84_RS02020 | - | 421101..421601 (-) | 501 | WP_031668899.1 | ImmA/IrrE family metallo-endopeptidase | - |
| G8O84_RS02025 | - | 421614..421940 (-) | 327 | WP_012951299.1 | helix-turn-helix domain-containing protein | - |
| G8O84_RS02030 | - | 422115..422306 (+) | 192 | WP_014930668.1 | helix-turn-helix transcriptional regulator | - |
| G8O84_RS02035 | - | 422404..422730 (+) | 327 | WP_012951301.1 | DUF771 domain-containing protein | - |
| G8O84_RS02040 | - | 422903..423817 (+) | 915 | WP_031672323.1 | conserved phage C-terminal domain-containing protein | - |
| G8O84_RS02045 | - | 423819..424175 (+) | 357 | WP_031668902.1 | MerR family transcriptional regulator | - |
| G8O84_RS02050 | - | 424172..424588 (+) | 417 | WP_031672324.1 | hypothetical protein | - |
| G8O84_RS02055 | - | 424585..424761 (+) | 177 | WP_023552249.1 | hypothetical protein | - |
| G8O84_RS02060 | - | 424849..425832 (+) | 984 | WP_031672325.1 | DNA cytosine methyltransferase | - |
| G8O84_RS02065 | - | 425829..426374 (+) | 546 | WP_049955978.1 | DUF1642 domain-containing protein | - |
| G8O84_RS02070 | - | 426392..426817 (+) | 426 | WP_031672575.1 | pentapeptide repeat-containing protein | - |
| G8O84_RS02075 | - | 426921..427304 (+) | 384 | WP_023552263.1 | hypothetical protein | - |
| G8O84_RS02080 | - | 427325..427573 (+) | 249 | WP_031668907.1 | ASCH/PUA domain-containing protein | - |
| G8O84_RS02085 | - | 427621..428154 (+) | 534 | WP_232133217.1 | DUF3310 domain-containing protein | - |
| G8O84_RS02090 | ssbA | 428154..428633 (+) | 480 | WP_031668909.1 | single-stranded DNA-binding protein | Machinery gene |
| G8O84_RS02095 | - | 428702..428878 (+) | 177 | WP_223196704.1 | hypothetical protein | - |
| G8O84_RS02100 | - | 428939..429457 (+) | 519 | WP_014930677.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| G8O84_RS02105 | - | 429454..429996 (+) | 543 | WP_012951317.1 | tyrosine-type recombinase/integrase | - |
| G8O84_RS02110 | - | 430280..430606 (+) | 327 | WP_023552285.1 | hypothetical protein | - |
| G8O84_RS15165 | - | 430744..430965 (+) | 222 | WP_223201765.1 | HNH endonuclease signature motif containing protein | - |
| G8O84_RS02120 | - | 431060..431587 (+) | 528 | WP_012951321.1 | phage terminase small subunit P27 family | - |
| G8O84_RS02125 | - | 431556..433307 (+) | 1752 | WP_012951322.1 | terminase large subunit | - |
| G8O84_RS02130 | - | 433314..433514 (+) | 201 | WP_023552290.1 | DUF1056 family protein | - |
| G8O84_RS02135 | - | 433517..434752 (+) | 1236 | WP_012951323.1 | phage portal protein | - |
| G8O84_RS02140 | - | 434749..435315 (+) | 567 | WP_012951324.1 | HK97 family phage prohead protease | - |
| G8O84_RS02145 | - | 435379..436548 (+) | 1170 | WP_012951325.1 | phage major capsid protein | - |
| G8O84_RS02150 | - | 436597..436935 (+) | 339 | WP_031672578.1 | head-tail connector protein | - |
| G8O84_RS02155 | - | 436905..437225 (+) | 321 | WP_012951327.1 | phage head closure protein | - |
| G8O84_RS02160 | - | 437219..437584 (+) | 366 | WP_012951328.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| G8O84_RS02165 | - | 437587..437985 (+) | 399 | WP_031672580.1 | hypothetical protein | - |
| G8O84_RS02170 | - | 438007..438582 (+) | 576 | WP_031672582.1 | major tail protein | - |
| G8O84_RS02175 | gpG | 438672..439019 (+) | 348 | WP_031669986.1 | phage tail assembly chaperone G | - |
| G8O84_RS02180 | - | 439312..443415 (+) | 4104 | WP_227876235.1 | phage tail tape measure protein | - |
| G8O84_RS02185 | - | 443408..445651 (+) | 2244 | WP_031672585.1 | distal tail protein Dit | - |
| G8O84_RS02190 | - | 445657..447948 (+) | 2292 | WP_068998205.1 | phage tail spike protein | - |
| G8O84_RS02195 | - | 447941..449005 (+) | 1065 | WP_031672587.1 | hypothetical protein | - |
| G8O84_RS02200 | - | 449053..449496 (+) | 444 | WP_009928178.1 | hypothetical protein | - |
| G8O84_RS02205 | - | 449475..449891 (+) | 417 | WP_031672588.1 | hypothetical protein | - |
| G8O84_RS02210 | - | 449912..450178 (+) | 267 | WP_031672590.1 | phage holin | - |
| G8O84_RS02215 | - | 450175..451002 (+) | 828 | WP_049955950.1 | N-acetylmuramoyl-L-alanine amidase | - |
| G8O84_RS02220 | - | 451076..451522 (-) | 447 | WP_049955951.1 | hypothetical protein | - |
| G8O84_RS02230 | - | 452726..453355 (+) | 630 | WP_009912342.1 | hypothetical protein | - |
| G8O84_RS02235 | - | 453995..454528 (+) | 534 | WP_010989534.1 | DUF3267 domain-containing protein | - |
| G8O84_RS02240 | - | 454592..455509 (+) | 918 | WP_003732615.1 | aldo/keto reductase family oxidoreductase | - |
| G8O84_RS02245 | - | 455775..457655 (+) | 1881 | WP_003722840.1 | heavy metal translocating P-type ATPase | - |
| G8O84_RS02250 | - | 457751..458479 (+) | 729 | WP_009930760.1 | hypothetical protein | - |
| G8O84_RS02255 | - | 458622..459272 (+) | 651 | WP_039385914.1 | transaldolase family protein | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 17461.36 Da Isoelectric Point: 5.2753
>NTDB_id=570507 G8O84_RS02090 WP_031668909.1 428154..428633(+) (ssbA) [Listeria monocytogenes strain 2BR25]
MMNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNAQGEQEADFINCVVWRKPAENVANFLKKGSMAGVDGRIQTR
NYEDNDGKRVFVTEVVAESVQFLEPKNNPGRATTNDYQSKANYSNNTQTSSYESGASQKGGAFVSDSKPIDISDDDLPF
MMNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNAQGEQEADFINCVVWRKPAENVANFLKKGSMAGVDGRIQTR
NYEDNDGKRVFVTEVVAESVQFLEPKNNPGRATTNDYQSKANYSNNTQTSSYESGASQKGGAFVSDSKPIDISDDDLPF
Nucleotide
Download Length: 480 bp
>NTDB_id=570507 G8O84_RS02090 WP_031668909.1 428154..428633(+) (ssbA) [Listeria monocytogenes strain 2BR25]
ATGATGAATCGTGTAGTACTTGTAGGTCGATTAACTAAAGACCCTGATTTACGATATACGCCAGCAGGCGCGGCTGTTGC
GACTTTTACATTAGCTGTAAATCGCCCATTTAAAAATGCACAAGGAGAACAAGAAGCCGATTTCATTAATTGTGTTGTTT
GGCGAAAACCAGCAGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCGGGCGTTGATGGTCGAATACAGACTCGA
AATTATGAGGACAACGACGGTAAACGCGTTTTTGTTACGGAAGTAGTTGCTGAATCAGTTCAATTCTTAGAGCCTAAAAA
CAACCCAGGGAGAGCTACAACGAATGATTATCAAAGCAAAGCTAATTATTCAAACAACACTCAAACAAGCTCATATGAAT
CGGGTGCGAGCCAGAAAGGCGGTGCGTTTGTTAGTGATAGCAAGCCAATCGATATTTCAGATGATGATTTGCCGTTTTAA
ATGATGAATCGTGTAGTACTTGTAGGTCGATTAACTAAAGACCCTGATTTACGATATACGCCAGCAGGCGCGGCTGTTGC
GACTTTTACATTAGCTGTAAATCGCCCATTTAAAAATGCACAAGGAGAACAAGAAGCCGATTTCATTAATTGTGTTGTTT
GGCGAAAACCAGCAGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCGGGCGTTGATGGTCGAATACAGACTCGA
AATTATGAGGACAACGACGGTAAACGCGTTTTTGTTACGGAAGTAGTTGCTGAATCAGTTCAATTCTTAGAGCCTAAAAA
CAACCCAGGGAGAGCTACAACGAATGATTATCAAAGCAAAGCTAATTATTCAAACAACACTCAAACAAGCTCATATGAAT
CGGGTGCGAGCCAGAAAGGCGGTGCGTTTGTTAGTGATAGCAAGCCAATCGATATTTCAGATGATGATTTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
63.953 |
100 |
0.692 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.857 |
100 |
0.604 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
66.981 |
66.667 |
0.447 |