Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   G8O95_RS11380 Genome accession   NZ_CP075873
Coordinates   2255670..2256152 (-) Length   160 a.a.
NCBI ID   WP_003722552.1    Uniprot ID   A0A3T2EU60
Organism   Listeria monocytogenes strain 2BR21     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2219680..2270937 2255670..2256152 within 0


Gene organization within MGE regions


Location: 2219680..2270937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G8O95_RS11210 - 2219680..2220483 (-) 804 WP_003726198.1 STAS domain-containing protein -
  G8O95_RS11215 - 2220508..2220930 (-) 423 WP_003726199.1 general stress protein -
  G8O95_RS11220 - 2220930..2224148 (-) 3219 WP_003723507.1 DEAD/DEAH box helicase -
  G8O95_RS11225 - 2224232..2227303 (-) 3072 WP_057171616.1 AAA family ATPase -
  G8O95_RS11230 - 2227300..2228424 (-) 1125 WP_003723509.1 exonuclease SbcCD subunit D -
  G8O95_RS11235 - 2228540..2229148 (+) 609 WP_003727338.1 1-acyl-sn-glycerol-3-phosphate acyltransferase -
  G8O95_RS11240 - 2229190..2229705 (-) 516 WP_010989770.1 hypothetical protein -
  G8O95_RS11245 - 2229879..2230367 (-) 489 WP_003723512.1 CcdC family protein -
  G8O95_RS11250 - 2230448..2232253 (-) 1806 WP_010989771.1 ABC transporter ATP-binding protein -
  G8O95_RS11255 - 2232237..2234006 (-) 1770 WP_003723514.1 ABC transporter ATP-binding protein -
  G8O95_RS11260 - 2234409..2235029 (-) 621 WP_009926312.1 cell surface protein -
  G8O95_RS11265 - 2235044..2235538 (-) 495 WP_003723516.1 matrixin family metalloprotease -
  G8O95_RS15280 - 2236041..2236115 (-) 75 Protein_2230 Gp23 family protein -
  G8O95_RS11275 - 2236154..2238319 (-) 2166 WP_023553771.1 phage tail spike protein -
  G8O95_RS11280 - 2238332..2239900 (-) 1569 WP_023552439.1 distal tail protein Dit -
  G8O95_RS11285 - 2239897..2244687 (-) 4791 WP_060587044.1 phage tail tape measure protein -
  G8O95_RS11290 - 2244692..2244967 (-) 276 WP_003733699.1 Gp15 family bacteriophage protein -
  G8O95_RS11295 - 2245000..2245431 (-) 432 WP_003733698.1 hypothetical protein -
  G8O95_RS11300 - 2245487..2246176 (-) 690 WP_003733697.1 phage tail tube protein -
  G8O95_RS11305 - 2246181..2246552 (-) 372 WP_003725064.1 hypothetical protein -
  G8O95_RS11310 - 2246549..2246866 (-) 318 WP_003733696.1 HK97 gp10 family phage protein -
  G8O95_RS11315 - 2246856..2247221 (-) 366 WP_003733695.1 hypothetical protein -
  G8O95_RS11320 - 2247221..2247574 (-) 354 WP_003723785.1 hypothetical protein -
  G8O95_RS11325 - 2247575..2247730 (-) 156 WP_003723786.1 hypothetical protein -
  G8O95_RS11330 - 2247744..2248616 (-) 873 WP_003723787.1 hypothetical protein -
  G8O95_RS11335 - 2248639..2249193 (-) 555 WP_003723788.1 hypothetical protein -
  G8O95_RS11340 - 2249289..2250332 (-) 1044 WP_023548506.1 phage minor capsid protein -
  G8O95_RS11345 - 2250337..2251893 (-) 1557 WP_023548504.1 hypothetical protein -
  G8O95_RS11350 - 2251908..2253227 (-) 1320 WP_038409838.1 PBSX family phage terminase large subunit -
  G8O95_RS11355 terS 2253166..2253936 (-) 771 WP_061128877.1 phage terminase small subunit -
  G8O95_RS11360 - 2253980..2254207 (-) 228 WP_023548498.1 hypothetical protein -
  G8O95_RS11365 - 2254483..2254917 (-) 435 WP_025370640.1 ArpU family phage packaging/lysis transcriptional regulator -
  G8O95_RS11370 - 2254982..2255452 (-) 471 WP_223196595.1 Holliday junction resolvase RecU -
  G8O95_RS11375 - 2255469..2255651 (-) 183 WP_209025655.1 hypothetical protein -
  G8O95_RS11380 ssbA 2255670..2256152 (-) 483 WP_003722552.1 single-stranded DNA-binding protein Machinery gene
  G8O95_RS11385 - 2256149..2256328 (-) 180 WP_003733878.1 hypothetical protein -
  G8O95_RS11390 - 2256432..2256599 (-) 168 WP_003722554.1 hypothetical protein -
  G8O95_RS11395 - 2256596..2257057 (-) 462 WP_023552261.1 hypothetical protein -
  G8O95_RS11400 - 2257054..2257242 (-) 189 WP_023552259.1 hypothetical protein -
  G8O95_RS11405 - 2257255..2257965 (-) 711 WP_023552257.1 hypothetical protein -
  G8O95_RS11410 - 2257965..2258348 (-) 384 WP_209025654.1 YopX family protein -
  G8O95_RS11415 - 2258345..2258542 (-) 198 WP_003722558.1 hypothetical protein -
  G8O95_RS11420 - 2258545..2259141 (-) 597 WP_003722559.1 DUF1642 domain-containing protein -
  G8O95_RS11425 - 2259138..2259950 (-) 813 WP_173346365.1 DNA adenine methylase -
  G8O95_RS11430 - 2259962..2260486 (-) 525 WP_372239031.1 sugar-phosphate nucleotidyltransferase -
  G8O95_RS11435 - 2260489..2261403 (-) 915 WP_003733679.1 DnaD domain-containing protein -
  G8O95_RS11440 - 2261441..2262352 (-) 912 WP_003723965.1 RecT family recombinase -
  G8O95_RS11445 - 2262345..2263856 (-) 1512 WP_003723967.1 AAA family ATPase -
  G8O95_RS11450 - 2264089..2264277 (-) 189 WP_003722564.1 gp45 family putative tail fiber system protein -
  G8O95_RS11455 - 2264380..2264586 (-) 207 WP_003733681.1 AlpA family transcriptional regulator -
  G8O95_RS11460 - 2264576..2265106 (-) 531 WP_003733682.1 hypothetical protein -
  G8O95_RS11465 - 2265230..2266006 (-) 777 WP_003733683.1 phage antirepressor Ant -
  G8O95_RS11470 - 2266070..2266267 (+) 198 WP_003733684.1 hypothetical protein -
  G8O95_RS11475 - 2266269..2266550 (-) 282 WP_003722567.1 hypothetical protein -
  G8O95_RS11480 - 2266576..2266860 (-) 285 WP_003733686.1 hypothetical protein -
  G8O95_RS11485 - 2266872..2267066 (-) 195 WP_003733687.1 hypothetical protein -
  G8O95_RS11490 - 2267087..2267296 (-) 210 WP_003733688.1 helix-turn-helix transcriptional regulator -
  G8O95_RS11495 - 2267411..2267884 (+) 474 WP_223168276.1 helix-turn-helix domain-containing protein -
  G8O95_RS11500 - 2267900..2268325 (+) 426 WP_214631470.1 ImmA/IrrE family metallo-endopeptidase -
  G8O95_RS11505 - 2268340..2269047 (+) 708 WP_003724016.1 hypothetical protein -
  G8O95_RS11510 - 2269106..2269711 (+) 606 WP_214631469.1 hypothetical protein -
  G8O95_RS11515 - 2269774..2270937 (+) 1164 WP_003724018.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 17837.65 Da        Isoelectric Point: 4.9909

>NTDB_id=570452 G8O95_RS11380 WP_003722552.1 2255670..2256152(-) (ssbA) [Listeria monocytogenes strain 2BR21]
MMNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQNGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEDNDGKRVFVTEVVAESVQFLEPKNNNVEGATSNNYQNKANYSNNNQTSSYRADTSQKSDSFASEGKPIDINEDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=570452 G8O95_RS11380 WP_003722552.1 2255670..2256152(-) (ssbA) [Listeria monocytogenes strain 2BR21]
ATGATGAATCGTGTAGTACTTGTAGGACGATTAACAAAAGATCCGGATTTACGTTACACTCCAGCAGGCGTAGCAGTCGC
GACTTTTACATTAGCAGTAAATCGTACATTCACTAATCAAAACGGAGAACGAGAAGCAGATTTCATTAATTGTGTTGTTT
GGCGCAAACCAGCAGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCGGGCGTTGATGGACGTGTTCAAACTCGT
AATTATGAGGATAACGACGGTAAACGTGTTTTCGTTACTGAGGTAGTTGCTGAATCAGTTCAATTCTTAGAACCTAAAAA
TAACAACGTAGAAGGTGCTACATCGAATAATTACCAAAACAAGGCTAATTATTCAAATAACAATCAAACAAGCTCATATC
GAGCGGATACGAGTCAGAAGAGCGATTCATTTGCAAGTGAAGGTAAGCCGATTGATATTAATGAAGATGATTTGCCATTT
TGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A3T2EU60

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.116

100

0.7
  ssb Latilactobacillus sakei subsp. sakei 23K

55.294

100

0.587
  ssbB Bacillus subtilis subsp. subtilis str. 168

63.208

66.25

0.419