Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   G8O93_RS12865 Genome accession   NZ_CP075872
Coordinates   2538691..2539173 (-) Length   160 a.a.
NCBI ID   WP_031672300.1    Uniprot ID   -
Organism   Listeria monocytogenes strain C7     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2518126..2557928 2538691..2539173 within 0


Gene organization within MGE regions


Location: 2518126..2557928
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G8O93_RS12745 - 2518126..2520084 (-) 1959 WP_256733224.1 phage tail spike protein -
  G8O93_RS12750 - 2520097..2521665 (-) 1569 WP_031672316.1 distal tail protein Dit -
  G8O93_RS12755 - 2521662..2526461 (-) 4800 WP_031672315.1 phage tail tape measure protein -
  G8O93_RS12760 - 2526466..2526741 (-) 276 WP_031644303.1 Gp15 family bacteriophage protein -
  G8O93_RS12765 - 2526774..2527205 (-) 432 WP_031672313.1 hypothetical protein -
  G8O93_RS12770 - 2527261..2527947 (-) 687 WP_031672312.1 phage tail tube protein -
  G8O93_RS12775 - 2527952..2528323 (-) 372 WP_003745007.1 hypothetical protein -
  G8O93_RS12780 - 2528320..2528637 (-) 318 WP_031672311.1 HK97 gp10 family phage protein -
  G8O93_RS12785 - 2528627..2528992 (-) 366 WP_014930192.1 hypothetical protein -
  G8O93_RS12790 - 2528992..2529345 (-) 354 WP_031672309.1 hypothetical protein -
  G8O93_RS12795 - 2529346..2529501 (-) 156 WP_003753498.1 hypothetical protein -
  G8O93_RS12800 - 2529515..2530387 (-) 873 WP_031672307.1 hypothetical protein -
  G8O93_RS12805 - 2530410..2530964 (-) 555 WP_031672306.1 hypothetical protein -
  G8O93_RS12810 - 2531060..2532100 (-) 1041 WP_031672304.1 phage minor capsid protein -
  G8O93_RS12815 - 2532105..2533661 (-) 1557 WP_031672303.1 hypothetical protein -
  G8O93_RS12820 - 2533676..2535022 (-) 1347 WP_049955942.1 PBSX family phage terminase large subunit -
  G8O93_RS12825 terS 2534988..2535728 (-) 741 WP_003740918.1 phage terminase small subunit -
  G8O93_RS12830 - 2535768..2535995 (-) 228 WP_031648712.1 hypothetical protein -
  G8O93_RS12835 - 2536043..2536642 (-) 600 WP_031648711.1 hypothetical protein -
  G8O93_RS12840 - 2537008..2537442 (-) 435 WP_003735131.1 ArpU family phage packaging/lysis transcriptional regulator -
  G8O93_RS12845 - 2537461..2537625 (-) 165 WP_003727776.1 hypothetical protein -
  G8O93_RS15720 - 2537636..2537761 (-) 126 WP_009924216.1 hypothetical protein -
  G8O93_RS12850 - 2537754..2538137 (-) 384 WP_009924217.1 DUF2481 family protein -
  G8O93_RS12855 - 2538141..2538545 (-) 405 WP_010989958.1 DUF1064 domain-containing protein -
  G8O93_RS12860 - 2538490..2538672 (-) 183 WP_009924219.1 hypothetical protein -
  G8O93_RS12865 ssbA 2538691..2539173 (-) 483 WP_031672300.1 single-stranded DNA-binding protein Machinery gene
  G8O93_RS12870 - 2539170..2539349 (-) 180 WP_003733878.1 hypothetical protein -
  G8O93_RS12875 - 2539453..2539620 (-) 168 WP_003722554.1 hypothetical protein -
  G8O93_RS12880 - 2539617..2540078 (-) 462 WP_003722555.1 hypothetical protein -
  G8O93_RS12885 - 2540075..2540545 (-) 471 WP_031672299.1 pentapeptide repeat-containing protein -
  G8O93_RS12890 - 2540542..2540985 (-) 444 WP_003722557.1 YopX family protein -
  G8O93_RS12895 - 2540982..2541179 (-) 198 WP_003722558.1 hypothetical protein -
  G8O93_RS12900 - 2541182..2541778 (-) 597 WP_003734130.1 DUF1642 domain-containing protein -
  G8O93_RS12905 - 2541775..2542587 (-) 813 WP_003722560.1 DNA adenine methylase -
  G8O93_RS12910 - 2542584..2543528 (-) 945 WP_003722561.1 DnaD domain-containing protein -
  G8O93_RS12915 - 2543548..2544363 (-) 816 WP_010991173.1 recombinase RecT -
  G8O93_RS12920 - 2544366..2545325 (-) 960 WP_077913986.1 YqaJ viral recombinase family protein -
  G8O93_RS12925 - 2545558..2545746 (-) 189 WP_003733629.1 gp45 family putative tail fiber system protein -
  G8O93_RS12930 - 2545851..2546087 (-) 237 WP_031669394.1 DUF771 domain-containing protein -
  G8O93_RS12935 - 2546093..2546617 (-) 525 WP_031669393.1 hypothetical protein -
  G8O93_RS12940 - 2546739..2547518 (-) 780 WP_031672372.1 phage antirepressor KilAC domain-containing protein -
  G8O93_RS12945 - 2547582..2547779 (+) 198 WP_015455157.1 hypothetical protein -
  G8O93_RS12950 - 2547781..2548062 (-) 282 WP_003727747.1 hypothetical protein -
  G8O93_RS12955 - 2548059..2548295 (-) 237 WP_003733634.1 hypothetical protein -
  G8O93_RS12960 - 2548307..2548501 (-) 195 WP_003733635.1 hypothetical protein -
  G8O93_RS12965 - 2548505..2548756 (-) 252 WP_010991180.1 helix-turn-helix domain-containing protein -
  G8O93_RS12970 - 2548905..2549387 (+) 483 WP_010991181.1 helix-turn-helix domain-containing protein -
  G8O93_RS12975 - 2549544..2549711 (+) 168 WP_003733638.1 hypothetical protein -
  G8O93_RS12980 - 2549767..2549985 (+) 219 WP_003747290.1 hypothetical protein -
  G8O93_RS12985 - 2550001..2550723 (+) 723 WP_031672370.1 hypothetical protein -
  G8O93_RS12990 - 2550744..2551451 (+) 708 WP_010991182.1 hypothetical protein -
  G8O93_RS12995 - 2551515..2552645 (+) 1131 WP_031672368.1 site-specific integrase -
  G8O93_RS13005 - 2552921..2554354 (-) 1434 WP_031672364.1 polysaccharide monooxygenase -
  G8O93_RS13010 clpP 2554511..2555107 (+) 597 WP_003722600.1 ATP-dependent Clp endopeptidase proteolytic subunit ClpP -
  G8O93_RS13015 - 2555153..2556544 (-) 1392 WP_003732491.1 amino acid permease -
  G8O93_RS13020 inlP 2556762..2557928 (+) 1167 WP_012952015.1 class 3 internalin InlP -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 17809.59 Da        Isoelectric Point: 4.9909

>NTDB_id=570412 G8O93_RS12865 WP_031672300.1 2538691..2539173(-) (ssbA) [Listeria monocytogenes strain C7]
MMNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQNGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEDNDGKRVFVTEAVAESVQFLEPKNNNVEGATSNNYQNKANYSNNNQTSSYRADTSQKSDSFASEGKPIDINEDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=570412 G8O93_RS12865 WP_031672300.1 2538691..2539173(-) (ssbA) [Listeria monocytogenes strain C7]
ATGATGAATCGTGTAGTACTTGTAGGACGATTAACAAAAGATCCGGATTTACGTTACACTCCAGCAGGCGTAGCAGTCGC
GACTTTTACATTAGCAGTAAATCGTACATTCACTAATCAAAACGGAGAACGAGAAGCAGATTTCATTAATTGTGTTGTTT
GGCGCAAACCAGCAGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCGGGCGTTGATGGACGTGTTCAAACTCGT
AATTATGAGGATAACGACGGTAAACGTGTTTTCGTTACTGAGGCAGTTGCTGAATCAGTTCAATTCTTAGAACCTAAAAA
TAACAACGTAGAAGGTGCTACATCGAATAATTACCAAAACAAGGCTAATTATTCAAATAACAATCAAACAAGCTCATATC
GAGCGGATACGAGTCAGAAGAGCGATTCATTTGCAAGTGAAGGTAAGCCGATTGATATTAATGAAGATGATTTGCCATTT
TGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

64.535

100

0.694
  ssb Latilactobacillus sakei subsp. sakei 23K

54.706

100

0.581
  ssbB Bacillus subtilis subsp. subtilis str. 168

62.264

66.25

0.412