Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KIL00_RS13310 Genome accession   NZ_CP075344
Coordinates   2552088..2552261 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain A1 - Midalam     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2547088..2557261
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIL00_RS13295 (KIL00_13295) gcvT 2547888..2548976 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  KIL00_RS13300 (KIL00_13300) yqhH 2549417..2551090 (+) 1674 WP_038829735.1 SNF2-related protein -
  KIL00_RS13305 (KIL00_13305) yqhG 2551111..2551905 (+) 795 WP_014480249.1 YqhG family protein -
  KIL00_RS13310 (KIL00_13310) sinI 2552088..2552261 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KIL00_RS13315 (KIL00_13315) sinR 2552295..2552630 (+) 336 WP_213783644.1 helix-turn-helix domain-containing protein Regulator
  KIL00_RS13320 (KIL00_13320) tasA 2552723..2553508 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  KIL00_RS13325 (KIL00_13325) sipW 2553572..2554144 (-) 573 WP_003230181.1 signal peptidase I -
  KIL00_RS13330 (KIL00_13330) tapA 2554128..2554889 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  KIL00_RS13335 (KIL00_13335) yqzG 2555161..2555487 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KIL00_RS13340 (KIL00_13340) spoIIT 2555529..2555708 (-) 180 WP_014480252.1 YqzE family protein -
  KIL00_RS13345 (KIL00_13345) comGG 2555779..2556153 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  KIL00_RS13350 (KIL00_13350) comGF 2556154..2556537 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  KIL00_RS13355 (KIL00_13355) comGE 2556563..2556910 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=568920 KIL00_RS13310 WP_003230187.1 2552088..2552261(+) (sinI) [Bacillus subtilis subsp. subtilis strain A1 - Midalam]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=568920 KIL00_RS13310 WP_003230187.1 2552088..2552261(+) (sinI) [Bacillus subtilis subsp. subtilis strain A1 - Midalam]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1