Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KIL00_RS13310 | Genome accession | NZ_CP075344 |
| Coordinates | 2552088..2552261 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain A1 - Midalam | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2547088..2557261
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KIL00_RS13295 (KIL00_13295) | gcvT | 2547888..2548976 (-) | 1089 | WP_017696204.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KIL00_RS13300 (KIL00_13300) | yqhH | 2549417..2551090 (+) | 1674 | WP_038829735.1 | SNF2-related protein | - |
| KIL00_RS13305 (KIL00_13305) | yqhG | 2551111..2551905 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| KIL00_RS13310 (KIL00_13310) | sinI | 2552088..2552261 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| KIL00_RS13315 (KIL00_13315) | sinR | 2552295..2552630 (+) | 336 | WP_213783644.1 | helix-turn-helix domain-containing protein | Regulator |
| KIL00_RS13320 (KIL00_13320) | tasA | 2552723..2553508 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| KIL00_RS13325 (KIL00_13325) | sipW | 2553572..2554144 (-) | 573 | WP_003230181.1 | signal peptidase I | - |
| KIL00_RS13330 (KIL00_13330) | tapA | 2554128..2554889 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KIL00_RS13335 (KIL00_13335) | yqzG | 2555161..2555487 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| KIL00_RS13340 (KIL00_13340) | spoIIT | 2555529..2555708 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| KIL00_RS13345 (KIL00_13345) | comGG | 2555779..2556153 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| KIL00_RS13350 (KIL00_13350) | comGF | 2556154..2556537 (-) | 384 | WP_029317913.1 | ComG operon protein ComGF | Machinery gene |
| KIL00_RS13355 (KIL00_13355) | comGE | 2556563..2556910 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=568920 KIL00_RS13310 WP_003230187.1 2552088..2552261(+) (sinI) [Bacillus subtilis subsp. subtilis strain A1 - Midalam]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=568920 KIL00_RS13310 WP_003230187.1 2552088..2552261(+) (sinI) [Bacillus subtilis subsp. subtilis strain A1 - Midalam]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |