Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   KIL00_RS13350 Genome accession   NZ_CP075344
Coordinates   2556154..2556537 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain A1 - Midalam     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2551154..2561537
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIL00_RS13310 (KIL00_13310) sinI 2552088..2552261 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KIL00_RS13315 (KIL00_13315) sinR 2552295..2552630 (+) 336 WP_213783644.1 helix-turn-helix domain-containing protein Regulator
  KIL00_RS13320 (KIL00_13320) tasA 2552723..2553508 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  KIL00_RS13325 (KIL00_13325) sipW 2553572..2554144 (-) 573 WP_003230181.1 signal peptidase I -
  KIL00_RS13330 (KIL00_13330) tapA 2554128..2554889 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  KIL00_RS13335 (KIL00_13335) yqzG 2555161..2555487 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KIL00_RS13340 (KIL00_13340) spoIIT 2555529..2555708 (-) 180 WP_014480252.1 YqzE family protein -
  KIL00_RS13345 (KIL00_13345) comGG 2555779..2556153 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  KIL00_RS13350 (KIL00_13350) comGF 2556154..2556537 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  KIL00_RS13355 (KIL00_13355) comGE 2556563..2556910 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  KIL00_RS13360 (KIL00_13360) comGD 2556894..2557325 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  KIL00_RS13365 (KIL00_13365) comGC 2557315..2557611 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  KIL00_RS13370 (KIL00_13370) comGB 2557625..2558662 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  KIL00_RS13375 (KIL00_13375) comGA 2558649..2559719 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KIL00_RS13380 (KIL00_13380) - 2559932..2560129 (-) 198 WP_014480259.1 CBS domain-containing protein -
  KIL00_RS13385 (KIL00_13385) corA 2560131..2561084 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=568923 KIL00_RS13350 WP_029317913.1 2556154..2556537(-) (comGF) [Bacillus subtilis subsp. subtilis strain A1 - Midalam]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=568923 KIL00_RS13350 WP_029317913.1 2556154..2556537(-) (comGF) [Bacillus subtilis subsp. subtilis strain A1 - Midalam]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(16-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976