Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   KIV13_RS11885 Genome accession   NZ_CP075055
Coordinates   2469603..2469980 (-) Length   125 a.a.
NCBI ID   WP_032866434.1    Uniprot ID   -
Organism   Bacillus velezensis strain YYC     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2464603..2474980
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIV13_RS11845 (KIV13_11845) - 2465101..2465895 (+) 795 WP_007408330.1 YqhG family protein -
  KIV13_RS11850 (KIV13_11850) sinI 2466072..2466245 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KIV13_RS11855 (KIV13_11855) sinR 2466279..2466614 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KIV13_RS11860 (KIV13_11860) tasA 2466662..2467447 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KIV13_RS11865 (KIV13_11865) sipW 2467512..2468096 (-) 585 WP_015240205.1 signal peptidase I SipW -
  KIV13_RS11870 (KIV13_11870) tapA 2468068..2468739 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  KIV13_RS11875 (KIV13_11875) - 2468998..2469327 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  KIV13_RS11880 (KIV13_11880) - 2469367..2469546 (-) 180 WP_003153093.1 YqzE family protein -
  KIV13_RS11885 (KIV13_11885) comGG 2469603..2469980 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  KIV13_RS19585 comGF 2469981..2470148 (-) 168 WP_235183824.1 ComGF family competence protein Machinery gene
  KIV13_RS19590 - 2470145..2470339 (-) 195 WP_225917419.1 hypothetical protein -
  KIV13_RS11895 (KIV13_11895) comGE 2470383..2470697 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  KIV13_RS11900 (KIV13_11900) comGD 2470681..2471118 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  KIV13_RS11905 (KIV13_11905) comGC 2471108..2471416 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KIV13_RS11910 (KIV13_11910) comGB 2471421..2472458 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  KIV13_RS11915 (KIV13_11915) comGA 2472445..2473515 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  KIV13_RS11920 (KIV13_11920) - 2473707..2474657 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14197.08 Da        Isoelectric Point: 9.7381

>NTDB_id=567553 KIV13_RS11885 WP_032866434.1 2469603..2469980(-) (comGG) [Bacillus velezensis strain YYC]
MYKSDGFIYPAVLFVSAAVLLVISYTTSDFITRKTFAKEAGEYWTGENLLQNGALLSSRHMTQGQRVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=567553 KIV13_RS11885 WP_032866434.1 2469603..2469980(-) (comGG) [Bacillus velezensis strain YYC]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTAC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGACCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAGGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGGCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488