Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KIV13_RS11850 | Genome accession | NZ_CP075055 |
| Coordinates | 2466072..2466245 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain YYC | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2461072..2471245
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KIV13_RS11835 (KIV13_11835) | gcvT | 2461885..2462985 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KIV13_RS11840 (KIV13_11840) | - | 2463409..2465079 (+) | 1671 | WP_007408331.1 | DEAD/DEAH box helicase | - |
| KIV13_RS11845 (KIV13_11845) | - | 2465101..2465895 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| KIV13_RS11850 (KIV13_11850) | sinI | 2466072..2466245 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| KIV13_RS11855 (KIV13_11855) | sinR | 2466279..2466614 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| KIV13_RS11860 (KIV13_11860) | tasA | 2466662..2467447 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| KIV13_RS11865 (KIV13_11865) | sipW | 2467512..2468096 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| KIV13_RS11870 (KIV13_11870) | tapA | 2468068..2468739 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KIV13_RS11875 (KIV13_11875) | - | 2468998..2469327 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| KIV13_RS11880 (KIV13_11880) | - | 2469367..2469546 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| KIV13_RS11885 (KIV13_11885) | comGG | 2469603..2469980 (-) | 378 | WP_032866434.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KIV13_RS19585 | comGF | 2469981..2470148 (-) | 168 | WP_235183824.1 | ComGF family competence protein | Machinery gene |
| KIV13_RS19590 | - | 2470145..2470339 (-) | 195 | WP_225917419.1 | hypothetical protein | - |
| KIV13_RS11895 (KIV13_11895) | comGE | 2470383..2470697 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| KIV13_RS11900 (KIV13_11900) | comGD | 2470681..2471118 (-) | 438 | WP_007408322.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=567551 KIV13_RS11850 WP_003153105.1 2466072..2466245(+) (sinI) [Bacillus velezensis strain YYC]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=567551 KIV13_RS11850 WP_003153105.1 2466072..2466245(+) (sinI) [Bacillus velezensis strain YYC]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |