Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   KH277_RS07715 Genome accession   NZ_CP075054
Coordinates   1494196..1494573 (+) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain VTX20     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1489196..1499573
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KH277_RS07680 (KH277_07680) - 1489512..1490462 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  KH277_RS07685 (KH277_07685) comGA 1490654..1491724 (+) 1071 WP_213390994.1 competence type IV pilus ATPase ComGA Machinery gene
  KH277_RS07690 (KH277_07690) comGB 1491711..1492748 (+) 1038 WP_213390995.1 competence type IV pilus assembly protein ComGB Machinery gene
  KH277_RS07695 (KH277_07695) comGC 1492795..1493061 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  KH277_RS07700 (KH277_07700) comGD 1493051..1493488 (+) 438 WP_014305413.1 competence type IV pilus minor pilin ComGD Machinery gene
  KH277_RS07705 (KH277_07705) comGE 1493472..1493786 (+) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  KH277_RS07710 (KH277_07710) comGF 1493800..1494195 (+) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  KH277_RS07715 (KH277_07715) comGG 1494196..1494573 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  KH277_RS07720 (KH277_07720) - 1494630..1494809 (+) 180 WP_003153093.1 YqzE family protein -
  KH277_RS07725 (KH277_07725) - 1494849..1495178 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KH277_RS07730 (KH277_07730) tapA 1495437..1496108 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  KH277_RS07735 (KH277_07735) - 1496080..1496664 (+) 585 WP_012117977.1 signal peptidase I -
  KH277_RS07740 (KH277_07740) - 1496728..1497513 (+) 786 WP_003153102.1 TasA family protein -
  KH277_RS07745 (KH277_07745) sinR 1497561..1497896 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KH277_RS07750 (KH277_07750) sinI 1497930..1498103 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  KH277_RS07755 (KH277_07755) - 1498280..1499074 (-) 795 WP_014305407.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=567472 KH277_RS07715 WP_014305410.1 1494196..1494573(+) (comGG) [Bacillus velezensis strain VTX20]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=567472 KH277_RS07715 WP_014305410.1 1494196..1494573(+) (comGG) [Bacillus velezensis strain VTX20]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512